format-version: 1.2 date: 2021:03:11 13:32 saved-by: psi-pi_team default-namespace: UNIMOD [Term] id: UNIMOD:0 name: unimod root node def: "The root node of the unimod modifications ontology." [UNIMOD:0] [Term] id: UNIMOD:1 name: Acetyl def: "Acetylation." [RESID:AA0048, RESID:AA0049, RESID:AA0041, RESID:AA0052, RESID:AA0364, RESID:AA0056, RESID:AA0046, RESID:AA0051, RESID:AA0045, RESID:AA0354, RESID:AA0044, RESID:AA0043, PMID:11999733, URL:http\://www.ionsource.com/Card/acetylation/acetylation.htm, RESID:AA0055, PMID:14730666, PMID:15350136, RESID:AA0047, PMID:12175151, PMID:11857757, RESID:AA0042, RESID:AA0050, RESID:AA0053, RESID:AA0054, FindMod:ACET, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1] xref: record_id "1" xref: delta_mono_mass "42.010565" xref: delta_avge_mass "42.0367" xref: delta_composition "H(2) C(2) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2017-11-08 16:08:56" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" xref: spec_1_misc_notes "PT and GIST acetyl light" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Multiple" xref: spec_2_misc_notes "GIST acetyl light" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_5_group "5" xref: spec_5_hidden "0" xref: spec_5_site "N-term" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Post-translational" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Post-translational" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "Y" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" xref: spec_7_misc_notes "O-acetyl" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "H" xref: spec_8_position "Anywhere" xref: spec_8_classification "Chemical derivative" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "R" xref: spec_9_position "Anywhere" xref: spec_9_classification "Artefact" xref: spec_9_misc_notes "glyoxal-derived hydroimidazolone" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2 name: Amidated def: "Amidation." [RESID:AA0088, RESID:AA0087, RESID:AA0086, RESID:AA0085, RESID:AA0084, RESID:AA0083, RESID:AA0082, RESID:AA0081, RESID:AA0089, RESID:AA0090, RESID:AA0091, RESID:AA0092, RESID:AA0093, RESID:AA0094, RESID:AA0095, RESID:AA0096, RESID:AA0097, RESID:AA0098, RESID:AA0099, RESID:AA0100, FindMod:AMID, PMID:14588022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2] synonym: "Top-Down sequencing c-type fragment ion" [] xref: record_id "2" xref: delta_mono_mass "-0.984016" xref: delta_avge_mass "-0.9848" xref: delta_composition "H N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2010-06-28 10:52:25" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_2_misc_notes "MS/MS experiments of mass spectrometric c-ions (MS^3) can be used for protein identification by library searching. T3-sequencing is such a technique (see reference). Search engines must recognize this as a virtual modification." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:3 name: Biotin def: "Biotinylation." [RESID:AA0117, FindMod:BIOT, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=3] xref: record_id "3" xref: delta_mono_mass "226.077598" xref: delta_avge_mass "226.2954" xref: delta_composition "H(14) C(10) N(2) O(2) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2017-10-09 15:45:09" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:4 name: Carbamidomethyl def: "Iodoacetamide derivative." [PMID:11510821, PMID:12422359, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=4] synonym: "Carboxyamidomethylation" [] xref: record_id "4" xref: delta_mono_mass "57.021464" xref: delta_avge_mass "57.0513" xref: delta_composition "H(3) C(2) N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2017-10-09 10:27:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "D" xref: spec_5_position "Anywhere" xref: spec_5_classification "Artefact" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "E" xref: spec_6_position "Anywhere" xref: spec_6_classification "Artefact" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "S" xref: spec_7_position "Anywhere" xref: spec_7_classification "Artefact" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "T" xref: spec_8_position "Anywhere" xref: spec_8_classification "Artefact" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "Y" xref: spec_9_position "Anywhere" xref: spec_9_classification "Artefact" xref: spec_10_group "10" xref: spec_10_hidden "1" xref: spec_10_site "U" xref: spec_10_position "Anywhere" xref: spec_10_classification "Chemical derivative" xref: spec_11_group "11" xref: spec_11_hidden "1" xref: spec_11_site "M" xref: spec_11_position "Anywhere" xref: spec_11_classification "Chemical derivative" xref: spec_11_neutral_loss_0_mono_mass "0" xref: spec_11_neutral_loss_0_avge_mass "0" xref: spec_11_neutral_loss_0_flag "false" xref: spec_11_neutral_loss_0_composition "0" xref: spec_11_neutral_loss_106_mono_mass "105.024835" xref: spec_11_neutral_loss_106_avge_mass "105.1588" xref: spec_11_neutral_loss_106_flag "false" xref: spec_11_neutral_loss_106_composition "H(7) C(3) N O S" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:5 name: Carbamyl def: "Carbamylation." [PMID:12203680, RESID:AA0343, PMID:10978403, RESID:AA0332, URL:http\://www.ionsource.com/Card/carbam/carbam.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=5] comment: Carbamylation is an irreversible process of non-enzymatic modification of proteins by the breakdown products of urea isocyanic acid reacts with the N-term of a proteine or side chains of lysine and arginine residues. xref: record_id "5" xref: delta_mono_mass "43.005814" xref: delta_avge_mass "43.0247" xref: delta_composition "H C N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2011-11-21 13:06:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Multiple" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "C" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "M" xref: spec_5_position "Anywhere" xref: spec_5_classification "Artefact" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "S" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "T" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "Y" xref: spec_8_position "Anywhere" xref: spec_8_classification "Chemical derivative" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "N-term" xref: spec_9_position "Protein N-term" xref: spec_9_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:6 name: Carboxymethyl def: "Iodoacetic acid derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=6] synonym: "Carboxymethylation" [] xref: record_id "6" xref: delta_mono_mass "58.005479" xref: delta_avge_mass "58.0361" xref: delta_composition "H(2) C(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2016-02-01 14:17:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "W" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_4_misc_notes "Hydroxylethanone" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "U" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:7 name: Deamidated def: "Deamidation." [PMID:6838602, RESID:AA0214, URL:http\://www.ionsource.com/Card/Deamidation/deamidation.htm, FindMod:CITR, RESID:AA0128, FindMod:FLAC, PMID:15700232, FindMod:DEAM, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=7] synonym: "phenyllactyl from N-term Phe Citrullination" [] xref: record_id "7" xref: delta_mono_mass "0.984016" xref: delta_avge_mass "0.9848" xref: delta_composition "H(-1) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2018-10-25 09:32:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "Convertion of glycosylated asparagine residues upon deglycosylation with PNGase F in H2O" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_2_misc_notes "Protein which is post-translationally modified by the de-imination of one or more arginine residues; Peptidylarginine deiminase (PAD) converts protein bound to citrulline" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_44_mono_mass "43.005814" xref: spec_2_neutral_loss_44_avge_mass "43.0247" xref: spec_2_neutral_loss_44_flag "false" xref: spec_2_neutral_loss_44_composition "H C N O" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "F" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:8 name: ICAT-G def: "Gygi ICAT(TM) d0." [PMID:10504701, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=8] xref: record_id "8" xref: delta_mono_mass "486.251206" xref: delta_avge_mass "486.6253" xref: delta_composition "H(38) C(22) N(4) O(6) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 17:00:43" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:9 name: ICAT-G:2H(8) def: "Gygi ICAT(TM) d8." [PMID:10504701, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=9] xref: record_id "9" xref: delta_mono_mass "494.30142" xref: delta_avge_mass "494.6746" xref: delta_composition "H(30) 2H(8) C(22) N(4) O(6) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 17:01:35" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:10 name: Met->Hse def: "Homoserine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=10] comment: Cyanogen bromide (CNBr) cleavage converts the C-term Met to either homoserine or homoserine lactone, depending on pH. xref: record_id "10" xref: delta_mono_mass "-29.992806" xref: delta_avge_mass "-30.0922" xref: delta_composition "H(-2) C(-1) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-13 15:40:08" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "M" xref: spec_1_position "Any C-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:11 name: Met->Hsl def: "Homoserine lactone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=11] comment: Cyanogen bromide (CNBr) cleavage converts the C-term Met to either homoserine or homoserine lactone, depending on pH. xref: record_id "11" xref: delta_mono_mass "-48.003371" xref: delta_avge_mass "-48.1075" xref: delta_composition "H(-4) C(-1) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-11-14 11:10:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "M" xref: spec_1_position "Any C-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:12 name: ICAT-D:2H(8) def: "Applied Biosystems original ICAT(TM) d8." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/images/icat_reagent.gif, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=12] xref: record_id "12" xref: delta_mono_mass "450.275205" xref: delta_avge_mass "450.6221" xref: delta_composition "H(26) 2H(8) C(20) N(4) O(5) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 16:56:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:13 name: ICAT-D def: "Applied Biosystems original ICAT(TM) d0." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/images/icat_reagent.gif, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=13] xref: record_id "13" xref: delta_mono_mass "442.224991" xref: delta_avge_mass "442.5728" xref: delta_composition "H(34) C(20) N(4) O(5) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 16:53:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:17 name: NIPCAM def: "N-isopropylcarboxamidomethyl." [PMID:8465942, PMID:11465505, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=17] synonym: "Dimethylacrylamide, DMA" [] xref: record_id "17" xref: delta_mono_mass "99.068414" xref: delta_avge_mass "99.1311" xref: delta_composition "H(9) C(5) N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 12:39:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:20 name: PEO-Iodoacetyl-LC-Biotin def: "Biotinyl-iodoacetamidyl-3,6-dioxaoctanediamine." [PMID:12038753, PMID:15253424, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=20] synonym: "Pierce EZ-Link PEO-Iodoacetyl Biotin" [] xref: record_id "20" xref: delta_mono_mass "414.193691" xref: delta_avge_mass "414.5196" xref: delta_composition "H(30) C(18) N(4) O(5) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-11-14 11:40:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:21 name: Phospho def: "Phosphorylation." [RESID:AA0036, URL:http\://www.ionsource.com/Card/phos/phos.htm, RESID:AA0037, RESID:AA0033, RESID:AA0038, RESID:AA0039, RESID:AA0222, FindMod:PHOS, RESID:AA0034, RESID:AA0035, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=21] comment: Neutral loss of phosphate is typically observed from Y/H/D/E/K/C, rather than the preferential loss of phosphoric acid from S/T. xref: record_id "21" xref: delta_mono_mass "79.966331" xref: delta_avge_mass "79.9799" xref: delta_composition "H O(3) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2018-08-13 13:42:59" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_neutral_loss_98_mono_mass "97.976896" xref: spec_1_neutral_loss_98_avge_mass "97.9952" xref: spec_1_neutral_loss_98_flag "false" xref: spec_1_neutral_loss_98_composition "H(3) O(4) P" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_98_mono_mass "97.976896" xref: spec_1_neutral_loss_98_avge_mass "97.9952" xref: spec_1_neutral_loss_98_flag "false" xref: spec_1_neutral_loss_98_composition "H(3) O(4) P" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "D" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_3_misc_notes "Rare" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_4_misc_notes "Rare" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "C" xref: spec_5_position "Anywhere" xref: spec_5_classification "Post-translational" xref: spec_5_misc_notes "Rare" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "R" xref: spec_6_position "Anywhere" xref: spec_6_classification "Post-translational" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "K" xref: spec_7_position "Anywhere" xref: spec_7_classification "Post-translational" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "E" xref: spec_8_position "Anywhere" xref: spec_8_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:23 name: Dehydrated def: "Dehydration." [FindMod:DHAS, RESID:AA0303, RESID:AA0302, RESID:AA0181, RESID:AA0182, FindMod:DHB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=23] synonym: "didehydroalanine C-terminal imide Prompt loss of phosphate from phosphorylated residue D-Succinimide" [] xref: record_id "23" xref: delta_mono_mass "-18.010565" xref: delta_avge_mass "-18.0153" xref: delta_composition "H(-2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-11-14 11:05:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Q" xref: spec_2_position "Protein C-term" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_3_misc_notes "beta-elimination" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_4_misc_notes "beta-elimination" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "Y" xref: spec_5_position "Anywhere" xref: spec_5_classification "Post-translational" xref: spec_5_misc_notes "beta-elimination" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "D" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "0" xref: spec_7_site "C" xref: spec_7_position "Any N-term" xref: spec_7_classification "Artefact" xref: spec_7_misc_notes "Pyro-carboxymethyl as a delta from Carboxymethyl-Cys" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:24 name: Propionamide def: "Acrylamide adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=24] xref: record_id "24" xref: delta_mono_mass "71.037114" xref: delta_avge_mass "71.0779" xref: delta_composition "H(5) C(3) N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2010-12-21 16:57:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:25 name: Pyridylacetyl def: "Pyridylacetyl." [PMID:9276974, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=25] xref: record_id "25" xref: delta_mono_mass "119.037114" xref: delta_avge_mass "119.1207" xref: delta_composition "H(5) C(7) N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 12:47:43" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:26 name: Pyro-carbamidomethyl def: "S-carbamoylmethylcysteine cyclization (N-terminus)." [PMID:12643538, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=26] comment: Cyclisation of N-term Carbamidomethyl-Cys or Carboxymethyl-Cys. The delta is relative to Cys. For a delta relative to alkylated Cys, see Ammonia-loss and Dehydrated. synonym: "Carboxymethyl-Cys cyclization (N-terminus) Carbamidomethyl-Cys cyclization (N-terminus)" [] xref: record_id "26" xref: delta_mono_mass "39.994915" xref: delta_avge_mass "40.0208" xref: delta_composition "C(2) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-11-14 11:05:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:27 name: Glu->pyro-Glu def: "Pyro-glu from E." [RESID:AA0031, PMID:8442665, FindMod:PYRE, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=27] xref: record_id "27" xref: delta_mono_mass "-18.010565" xref: delta_avge_mass "-18.0153" xref: delta_composition "H(-2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2008-06-05 13:54:56" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "E" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:28 name: Gln->pyro-Glu def: "Pyro-glu from Q." [RESID:AA0031, FindMod:PYRR, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=28] xref: record_id "28" xref: delta_mono_mass "-17.026549" xref: delta_avge_mass "-17.0305" xref: delta_composition "H(-3) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-13 17:06:57" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "Q" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:29 name: SMA def: "N-Succinimidyl-2-morpholine acetate." [PMID:10446193, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=29] xref: record_id "29" xref: delta_mono_mass "127.063329" xref: delta_avge_mass "127.1412" xref: delta_composition "H(9) C(6) N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2010-11-03 17:44:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:30 name: Cation:Na def: "Sodium adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=30] comment: Proton replaced by sodium cation. xref: record_id "30" xref: delta_mono_mass "21.981943" xref: delta_avge_mass "21.9818" xref: delta_composition "H(-1) Na" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-14 19:43:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:31 name: Pyridylethyl def: "S-pyridylethylation." [PMID:11760118, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=31] xref: record_id "31" xref: delta_mono_mass "105.057849" xref: delta_avge_mass "105.1372" xref: delta_composition "H(7) C(7) N" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 12:43:38" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:34 name: Methyl def: "Methylation." [RESID:AA0105, PMID:11875433, RESID:AA0072, RESID:AA0299, RESID:AA0337, RESID:AA0317, RESID:AA0273, RESID:AA0234, RESID:AA0073, RESID:AA0070, RESID:AA0071, RESID:AA0076, RESID:AA0272, RESID:AA0305, RESID:AA0336, RESID:AA0069, RESID:AA0065, RESID:AA0063, RESID:AA0061, RESID:AA0064, RESID:AA0338, RESID:AA0318, FindMod:METH, URL:http\://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=2921173&tool=pmcentrez&rendertype=abstract, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=34] synonym: "methyl ester" [] xref: record_id "34" xref: delta_mono_mass "14.01565" xref: delta_avge_mass "14.0266" xref: delta_composition "H(2) C" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2015-08-26 14:39:25" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Any N-term" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Q" xref: spec_6_position "Anywhere" xref: spec_6_classification "Post-translational" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "R" xref: spec_7_position "Anywhere" xref: spec_7_classification "Post-translational" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "I" xref: spec_8_position "Anywhere" xref: spec_8_classification "Post-translational" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "L" xref: spec_9_position "Anywhere" xref: spec_9_classification "Post-translational" xref: spec_10_group "10" xref: spec_10_hidden "1" xref: spec_10_site "N-term" xref: spec_10_position "Protein N-term" xref: spec_10_classification "Post-translational" xref: spec_11_group "11" xref: spec_11_hidden "0" xref: spec_11_site "C-term" xref: spec_11_position "Any C-term" xref: spec_11_classification "Multiple" xref: spec_12_group "12" xref: spec_12_hidden "0" xref: spec_12_site "E" xref: spec_12_position "Anywhere" xref: spec_12_classification "Post-translational" xref: spec_12_group "12" xref: spec_12_hidden "0" xref: spec_12_site "D" xref: spec_12_position "Anywhere" xref: spec_12_classification "Post-translational" xref: spec_13_group "13" xref: spec_13_hidden "1" xref: spec_13_site "S" xref: spec_13_position "Anywhere" xref: spec_13_classification "Post-translational" xref: spec_14_group "14" xref: spec_14_hidden "1" xref: spec_14_site "T" xref: spec_14_position "Anywhere" xref: spec_14_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:35 name: Oxidation def: "Oxidation or Hydroxylation." [RESID:AA0027, PMID:11461766, RESID:AA0029, RESID:AA0028, RESID:AA0030, PMID:9004526, RESID:AA0205, RESID:AA0146, FindMod:DOPA, RESID:AA0215, FindMod:CSEA, RESID:AA0026, PMID:14661084, PMID:15569593, PMID:11120890, PMID:11212008, RESID:AA0322, RESID:AA0235, FindMod:HYDR, PMID:14661085, PMID:12781462, PMID:2057999, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=35] xref: record_id "35" xref: delta_mono_mass "15.994915" xref: delta_avge_mass "15.9994" xref: delta_composition "O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2017-10-06 17:05:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "3-hydroxyaspartic acid" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_3_misc_notes "3-hydroxyasparagine" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "P" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_4_misc_notes "glutamic semialdehyde" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "F" xref: spec_5_position "Anywhere" xref: spec_5_classification "Artefact" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Post-translational" xref: spec_6_misc_notes "dihydroxyphenylalanine (DOPA)" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "R" xref: spec_7_position "Anywhere" xref: spec_7_classification "Post-translational" xref: spec_8_group "8" xref: spec_8_hidden "0" xref: spec_8_site "M" xref: spec_8_position "Anywhere" xref: spec_8_classification "Artefact" xref: spec_8_misc_notes "methionine sulfoxide" xref: spec_8_neutral_loss_0_mono_mass "0" xref: spec_8_neutral_loss_0_avge_mass "0" xref: spec_8_neutral_loss_0_flag "false" xref: spec_8_neutral_loss_0_composition "0" xref: spec_8_neutral_loss_64_mono_mass "63.998285" xref: spec_8_neutral_loss_64_avge_mass "64.1069" xref: spec_8_neutral_loss_64_flag "false" xref: spec_8_neutral_loss_64_composition "H(4) C O S" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "C" xref: spec_9_position "Anywhere" xref: spec_9_classification "Post-translational" xref: spec_9_misc_notes "sulfenic acid" xref: spec_10_group "10" xref: spec_10_hidden "0" xref: spec_10_site "W" xref: spec_10_position "Anywhere" xref: spec_10_classification "Artefact" xref: spec_10_group "10" xref: spec_10_hidden "0" xref: spec_10_site "H" xref: spec_10_position "Anywhere" xref: spec_10_classification "Artefact" xref: spec_10_misc_notes "2-oxohistidine" xref: spec_11_group "11" xref: spec_11_hidden "1" xref: spec_11_site "G" xref: spec_11_position "Any C-term" xref: spec_11_classification "Pre-translational" xref: spec_11_misc_notes "Hydroxyglycine derivative in amidation pathway" xref: spec_12_group "12" xref: spec_12_hidden "1" xref: spec_12_site "U" xref: spec_12_position "Anywhere" xref: spec_12_classification "Multiple" xref: spec_13_group "13" xref: spec_13_hidden "1" xref: spec_13_site "E" xref: spec_13_position "Anywhere" xref: spec_13_classification "Chemical derivative" xref: spec_13_misc_notes "hydroxyglutamic acid" xref: spec_14_group "14" xref: spec_14_hidden "1" xref: spec_14_site "I" xref: spec_14_position "Anywhere" xref: spec_14_classification "Chemical derivative" xref: spec_15_group "15" xref: spec_15_hidden "1" xref: spec_15_site "L" xref: spec_15_position "Anywhere" xref: spec_15_classification "Chemical derivative" xref: spec_16_group "16" xref: spec_16_hidden "1" xref: spec_16_site "Q" xref: spec_16_position "Anywhere" xref: spec_16_classification "Chemical derivative" xref: spec_17_group "17" xref: spec_17_hidden "1" xref: spec_17_site "S" xref: spec_17_position "Anywhere" xref: spec_17_classification "Chemical derivative" xref: spec_18_group "18" xref: spec_18_hidden "1" xref: spec_18_site "T" xref: spec_18_position "Anywhere" xref: spec_18_classification "Chemical derivative" xref: spec_19_group "19" xref: spec_19_hidden "1" xref: spec_19_site "V" xref: spec_19_position "Anywhere" xref: spec_19_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:36 name: Dimethyl def: "Di-Methylation." [FindMod:DIMETH, RESID:AA0311, RESID:AA0068, PMID:14570711, RESID:AA0067, PMID:12964758, RESID:AA0075, RESID:AA0066, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=36] xref: record_id "36" xref: delta_mono_mass "28.0313" xref: delta_avge_mass "28.0532" xref: delta_composition "H(4) C(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2014-11-16 07:37:54" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "P" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Post-translational" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "N-term" xref: spec_6_position "Protein N-term" xref: spec_6_classification "Isotopic label" xref: spec_6_misc_notes "When dimethyl labelling is pre-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:37 name: Trimethyl def: "Tri-Methylation." [FindMod:TRIMETH, RESID:AA0062, RESID:AA0074, PMID:12590383, URL:http\://pir.georgetown.edu/resid/faq.shtml#q12, URL:http\://www.cancerci.com/content/1/1/3, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=37] xref: record_id "37" xref: delta_mono_mass "42.04695" xref: delta_avge_mass "42.0797" xref: delta_composition "H(6) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2015-05-22 13:05:59" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_60_mono_mass "59.073499" xref: spec_1_neutral_loss_60_avge_mass "59.1103" xref: spec_1_neutral_loss_60_flag "false" xref: spec_1_neutral_loss_60_composition "H(9) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "A" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:39 name: Methylthio def: "Beta-methylthiolation." [RESID:AA0320, PMID:8844851, URL:http\://www.trc-canada.com/white_papers.lasso, RESID:AA0232, URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, RESID:AA0101, FindMod:BMTH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=39] synonym: "Methyl methanethiosulfonate MMTS" [] xref: record_id "39" xref: delta_mono_mass "45.987721" xref: delta_avge_mass "46.0916" xref: delta_composition "H(2) C S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2011-11-24 16:48:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Multiple" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Any N-term" xref: spec_4_classification "Artefact" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "K" xref: spec_5_position "Anywhere" xref: spec_5_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:40 name: Sulfo def: "O-Sulfonation." [RESID:AA0172, PMID:14752058, RESID:AA0362, FindMod:SULF, RESID:AA0171, RESID:AA0361, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=40] xref: record_id "40" xref: delta_mono_mass "79.956815" xref: delta_avge_mass "80.0632" xref: delta_composition "O(3) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2012-02-14 17:50:32" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "Because the modification is quantitatively lost on CID, site assigment is not possible when there is a choice of sites" xref: spec_1_neutral_loss_80_mono_mass "79.956815" xref: spec_1_neutral_loss_80_avge_mass "80.0632" xref: spec_1_neutral_loss_80_flag "false" xref: spec_1_neutral_loss_80_composition "O(3) S" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "Because the modification is quantitatively lost on CID, site assigment is not possible when there is a choice of sites" xref: spec_1_neutral_loss_80_mono_mass "79.956815" xref: spec_1_neutral_loss_80_avge_mass "80.0632" xref: spec_1_neutral_loss_80_flag "false" xref: spec_1_neutral_loss_80_composition "O(3) S" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "Because the modification is quantitatively lost on CID, site assigment is not possible when there is a choice of sites" xref: spec_1_neutral_loss_80_mono_mass "79.956815" xref: spec_1_neutral_loss_80_avge_mass "80.0632" xref: spec_1_neutral_loss_80_flag "false" xref: spec_1_neutral_loss_80_composition "O(3) S" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_2_misc_notes "Sulfitolysis" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:41 name: Hex def: "Hexose." [RESID:AA0217, RESID:AA0152, PMID:15279557, FindMod:GLUC, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&mode=exact, RESID:AA0157, FindMod:CMAN, RESID:AA0327, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=41] synonym: "Fructose Mannose Galactose Glucose" [] xref: record_id "41" xref: delta_mono_mass "162.052824" xref: delta_avge_mass "162.1406" xref: delta_composition "Hex" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2018-06-27 13:23:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_1_misc_notes "glycation" xref: spec_1_neutral_loss_55_mono_mass "54.031694" xref: spec_1_neutral_loss_55_avge_mass "54.0458" xref: spec_1_neutral_loss_55_flag "false" xref: spec_1_neutral_loss_55_composition "H(6) O(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_1_misc_notes "glycation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_55_mono_mass "54.031694" xref: spec_1_neutral_loss_55_avge_mass "54.0458" xref: spec_1_neutral_loss_55_flag "false" xref: spec_1_neutral_loss_55_composition "H(6) O(3)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_163_mono_mass "162.052824" xref: spec_2_neutral_loss_163_avge_mass "162.1406" xref: spec_2_neutral_loss_163_flag "false" xref: spec_2_neutral_loss_163_composition "Hex" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Other glycosylation" xref: spec_3_misc_notes "glycation" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_55_mono_mass "54.031694" xref: spec_3_neutral_loss_55_avge_mass "54.0458" xref: spec_3_neutral_loss_55_flag "false" xref: spec_3_neutral_loss_55_composition "H(6) O(3)" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "O-linked glycosylation" xref: spec_4_neutral_loss_163_mono_mass "162.052824" xref: spec_4_neutral_loss_163_avge_mass "162.1406" xref: spec_4_neutral_loss_163_flag "false" xref: spec_4_neutral_loss_163_composition "Hex" xref: spec_4_neutral_loss_0_mono_mass "0" xref: spec_4_neutral_loss_0_avge_mass "0" xref: spec_4_neutral_loss_0_flag "false" xref: spec_4_neutral_loss_0_composition "0" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "O-linked glycosylation" xref: spec_4_neutral_loss_163_mono_mass "162.052824" xref: spec_4_neutral_loss_163_avge_mass "162.1406" xref: spec_4_neutral_loss_163_flag "false" xref: spec_4_neutral_loss_163_composition "Hex" xref: spec_4_neutral_loss_0_mono_mass "0" xref: spec_4_neutral_loss_0_avge_mass "0" xref: spec_4_neutral_loss_0_flag "false" xref: spec_4_neutral_loss_0_composition "0" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "W" xref: spec_5_position "Anywhere" xref: spec_5_classification "Other glycosylation" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "C" xref: spec_6_position "Anywhere" xref: spec_6_classification "Other glycosylation" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "Y" xref: spec_8_position "Anywhere" xref: spec_8_classification "O-linked glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:42 name: Lipoyl def: "Lipoyl." [RESID:AA0118, FindMod:LIPY, PMID:3522581, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=42] comment: This group is normally a substituent on N6 of a lysine residue of an enzyme or other protein. xref: record_id "42" xref: delta_mono_mass "188.032956" xref: delta_avge_mass "188.3103" xref: delta_composition "H(12) C(8) O S(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 15:06:53" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:43 name: HexNAc def: "N-Acetylhexosamine." [RESID:AA0151, FindMod:GLCN, RESID:AA0155, PMID:3086323, RESID:AA0154, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=43] comment: The amine derivative of a hexose formed by replacing a hydroxyl group with an amino group.(+acetyl group). xref: record_id "43" xref: delta_mono_mass "203.079373" xref: delta_avge_mass "203.1925" xref: delta_composition "HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2017-03-30 14:45:58" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_204_mono_mass "203.079373" xref: spec_1_neutral_loss_204_avge_mass "203.1925" xref: spec_1_neutral_loss_204_flag "false" xref: spec_1_neutral_loss_204_composition "HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_204_mono_mass "203.079373" xref: spec_2_neutral_loss_204_avge_mass "203.1925" xref: spec_2_neutral_loss_204_flag "false" xref: spec_2_neutral_loss_204_composition "HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_204_mono_mass "203.079373" xref: spec_2_neutral_loss_204_avge_mass "203.1925" xref: spec_2_neutral_loss_204_flag "false" xref: spec_2_neutral_loss_204_composition "HexNAc" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other glycosylation" xref: spec_3_neutral_loss_204_mono_mass "203.079373" xref: spec_3_neutral_loss_204_avge_mass "203.1925" xref: spec_3_neutral_loss_204_flag "false" xref: spec_3_neutral_loss_204_composition "HexNAc" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:44 name: Farnesyl def: "Farnesylation." [PMID:15609361, RESID:AA0102, FindMod:FARN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=44] xref: record_id "44" xref: delta_mono_mass "204.187801" xref: delta_avge_mass "204.3511" xref: delta_composition "H(24) C(15)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 15:11:38" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:45 name: Myristoyl def: "Myristoylation." [RESID:AA0059, RESID:AA0307, RESID:AA0078, FindMod:MYRI, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=45] xref: record_id "45" xref: delta_mono_mass "210.198366" xref: delta_avge_mass "210.3556" xref: delta_composition "H(26) C(14) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 15:13:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Any N-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:46 name: PyridoxalPhosphate def: "Pyridoxal phosphate." [RESID:AA0119, FindMod:PLP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=46] comment: The co-enzyme derivative of vitamin B6. Forms Schiff\'s bases of substrate amino acids during catalysis of transamination, decarboxylation and racemisation reactions. xref: record_id "46" xref: delta_mono_mass "229.014009" xref: delta_avge_mass "229.1266" xref: delta_composition "H(8) C(8) N O(5) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 15:35:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:47 name: Palmitoyl def: "Palmitoylation." [RESID:AA0080, RESID:AA0079, RESID:AA0106, RESID:AA0077, FindMod:PALM, RESID:AA0339, RESID:AA0060, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=47] comment: Palmitoylation is a post-translational modification that consists in the addition of a 16 carbons fatty acid, palmitate, to a cysteine residue through the creation of a thioester link. xref: record_id "47" xref: delta_mono_mass "238.229666" xref: delta_avge_mass "238.4088" xref: delta_composition "H(30) C(16) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 15:38:43" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:48 name: GeranylGeranyl def: "Geranyl-geranyl." [RESID:AA0104, PMID:15609361, FindMod:GERA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=48] xref: record_id "48" xref: delta_mono_mass "272.250401" xref: delta_avge_mass "272.4681" xref: delta_composition "H(32) C(20)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 15:47:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:49 name: Phosphopantetheine def: "Phosphopantetheine." [RESID:AA0150, FindMod:PPAN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=49] comment: Protein which contains at least one phosphopantetheine as the prosthetic group. In acyl carrier proteins (ACP) for example, it serves as a \'swinging arm\' for the attachment of activated fatty acid and amino-acid groups. xref: record_id "49" xref: delta_mono_mass "340.085794" xref: delta_avge_mass "340.333" xref: delta_composition "H(21) C(11) N(2) O(6) P S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 16:00:24" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:50 name: FAD def: "Flavin adenine dinucleotide." [RESID:AA0143, URL:http\://www.aw-bc.com/mathews/EF/FAD.GIF, RESID:AA0144, RESID:AA0145, RESID:AA0221, FindMod:FAD, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=50] xref: record_id "50" xref: delta_mono_mass "783.141486" xref: delta_avge_mass "783.5339" xref: delta_composition "H(31) C(27) N(9) O(15) P(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-16 17:16:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:51 name: Tripalmitate def: "N-acyl diglyceride cysteine." [PMID:10356335, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=51] xref: record_id "51" xref: delta_mono_mass "788.725777" xref: delta_avge_mass "789.3049" xref: delta_composition "H(96) C(51) O(5)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2006-10-18 11:47:54" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:52 name: Guanidinyl def: "Guanidination." [PMID:11821862, URL:http\://www.indiana.edu/~reillyjp/ASMS2001posters/beardsley_poster.pdf, PMID:11078590, PMID:11085420, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=52] comment: Specific for sidechain of lysine. Does not modify the N-termini except for glycine at a slower rate than the side chain of lysine. synonym: "homoarginine" [] xref: record_id "52" xref: delta_mono_mass "42.021798" xref: delta_avge_mass "42.04" xref: delta_composition "H(2) C N(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2011-11-21 13:56:40" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:53 name: HNE def: "4-hydroxynonenal (HNE)." [PMID:11327326, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=53] comment: A lipid-type modification. HNE forms a Michael addition product on Cysteine, Histidine and Lysines. Unusually, it doesn\'t replace a hydrogen on the amino acid side chain. xref: record_id "53" xref: delta_mono_mass "156.11503" xref: delta_avge_mass "156.2221" xref: delta_composition "H(16) C(9) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-08-19 19:17:11" xref: date_time_modified "2012-03-09 11:21:00" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "A" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_4_misc_notes "GFAP from human brain tissues" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "L" xref: spec_5_position "Anywhere" xref: spec_5_classification "Post-translational" xref: spec_5_misc_notes "GFAP from human brain tissues" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:54 name: Glucuronyl def: "Hexuronic acid." [PMID:7398618, RESID:AA0291, RESID:AA0058, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=54] comment: The addition of a sugar unit to a protein amino acid, e.g. the addition of glycan chains to proteins. Addition of glucuronic acid. Observed for N-term G. synonym: "glucuronosyl" [] xref: record_id "54" xref: delta_mono_mass "176.032088" xref: delta_avge_mass "176.1241" xref: delta_composition "HexA" xref: username_of_poster "jcottrell" xref: group_of_poster "users" xref: date_time_posted "2002-10-01 21:36:48" xref: date_time_modified "2017-11-16 14:51:01" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Other glycosylation" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_177_mono_mass "176.032088" xref: spec_2_neutral_loss_177_avge_mass "176.1241" xref: spec_2_neutral_loss_177_flag "false" xref: spec_2_neutral_loss_177_composition "HexA" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_177_mono_mass "176.032088" xref: spec_2_neutral_loss_177_avge_mass "176.1241" xref: spec_2_neutral_loss_177_flag "false" xref: spec_2_neutral_loss_177_composition "HexA" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:55 name: Glutathione def: "Glutathione disulfide." [PMID:3083866, PMID:8344916, RESID:AA0229, FindMod:GLUT, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=55] xref: record_id "55" xref: delta_mono_mass "305.068156" xref: delta_avge_mass "305.3076" xref: delta_composition "H(15) C(10) N(3) O(6) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2002-10-03 09:10:19" xref: date_time_modified "2006-10-16 15:51:52" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:56 name: Acetyl:2H(3) def: "Acetate labeling reagent (N-term & K) (heavy form, +3amu)." [PMID:11857757, PMID:11999733, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=56] synonym: "N-trideuteriumacetoxy" [] xref: record_id "56" xref: delta_mono_mass "45.029395" xref: delta_avge_mass "45.0552" xref: delta_composition "H(-1) 2H(3) C(2) O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 16:41:56" xref: date_time_modified "2011-11-21 10:07:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "H" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "N-term" xref: spec_7_position "Protein N-term" xref: spec_7_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:58 name: Propionyl def: "Propionate labeling reagent light form (N-term & K)." [PMID:12175151, PMID:11999733, PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=58] xref: record_id "58" xref: delta_mono_mass "56.026215" xref: delta_avge_mass "56.0633" xref: delta_composition "H(4) C(3) O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 16:52:38" xref: date_time_modified "2011-11-25 11:01:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:59 name: Propionyl:13C(3) def: "Propionate labeling reagent heavy form (+3amu), N-term & K." [PMID:11857757, PMID:12175151, PMID:11999733, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=59] xref: record_id "59" xref: delta_mono_mass "59.036279" xref: delta_avge_mass "59.0412" xref: delta_composition "H(4) 13C(3) O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 16:55:47" xref: date_time_modified "2006-10-16 10:27:21" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:60 name: GIST-Quat def: "Quaternary amine labeling reagent light form (N-term & K)." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=60] synonym: "N-(4-trimethylammoniumbutanoxy)-NHS" [] xref: record_id "60" xref: delta_mono_mass "127.099714" xref: delta_avge_mass "127.1842" xref: delta_composition "H(13) C(7) N O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:02:37" xref: date_time_modified "2006-10-16 13:39:27" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_neutral_loss_60_mono_mass "59.073499" xref: spec_1_neutral_loss_60_avge_mass "59.1103" xref: spec_1_neutral_loss_60_flag "false" xref: spec_1_neutral_loss_60_composition "H(9) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_neutral_loss_60_mono_mass "59.073499" xref: spec_2_neutral_loss_60_avge_mass "59.1103" xref: spec_2_neutral_loss_60_flag "false" xref: spec_2_neutral_loss_60_composition "H(9) C(3) N" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:61 name: GIST-Quat:2H(3) def: "Quaternary amine labeling reagent heavy (+3amu) form, N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=61] xref: record_id "61" xref: delta_mono_mass "130.118544" xref: delta_avge_mass "130.2027" xref: delta_composition "H(10) 2H(3) C(7) N O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:09:34" xref: date_time_modified "2006-10-16 13:40:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_neutral_loss_63_mono_mass "62.09233" xref: spec_1_neutral_loss_63_avge_mass "62.1287" xref: spec_1_neutral_loss_63_flag "false" xref: spec_1_neutral_loss_63_composition "H(6) 2H(3) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_neutral_loss_63_mono_mass "62.09233" xref: spec_2_neutral_loss_63_avge_mass "62.1287" xref: spec_2_neutral_loss_63_flag "false" xref: spec_2_neutral_loss_63_composition "H(6) 2H(3) C(3) N" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:62 name: GIST-Quat:2H(6) def: "Quaternary amine labeling reagent heavy form (+6amu), N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=62] xref: record_id "62" xref: delta_mono_mass "133.137375" xref: delta_avge_mass "133.2212" xref: delta_composition "H(7) 2H(6) C(7) N O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:12:27" xref: date_time_modified "2006-10-16 13:40:56" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_neutral_loss_66_mono_mass "65.11116" xref: spec_1_neutral_loss_66_avge_mass "65.1472" xref: spec_1_neutral_loss_66_flag "false" xref: spec_1_neutral_loss_66_composition "H(3) 2H(6) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_neutral_loss_66_mono_mass "65.11116" xref: spec_2_neutral_loss_66_avge_mass "65.1472" xref: spec_2_neutral_loss_66_flag "false" xref: spec_2_neutral_loss_66_composition "H(3) 2H(6) C(3) N" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:63 name: GIST-Quat:2H(9) def: "Quaternary amine labeling reagent heavy form (+9amu), N-term & K." [PMID:11857757, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=63] xref: record_id "63" xref: delta_mono_mass "136.156205" xref: delta_avge_mass "136.2397" xref: delta_composition "H(4) 2H(9) C(7) N O" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:14:22" xref: date_time_modified "2006-10-16 13:41:45" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_neutral_loss_69_mono_mass "68.12999" xref: spec_1_neutral_loss_69_avge_mass "68.1657" xref: spec_1_neutral_loss_69_flag "false" xref: spec_1_neutral_loss_69_composition "2H(9) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_neutral_loss_69_mono_mass "68.12999" xref: spec_2_neutral_loss_69_avge_mass "68.1657" xref: spec_2_neutral_loss_69_flag "false" xref: spec_2_neutral_loss_69_composition "2H(9) C(3) N" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:64 name: Succinyl def: "Succinic anhydride labeling reagent light form (N-term & K)." [PMID:12175151, PMID:11857757, RESID:AA0130, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=64] xref: record_id "64" xref: delta_mono_mass "100.016044" xref: delta_avge_mass "100.0728" xref: delta_composition "H(4) C(4) O(3)" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:17:07" xref: date_time_modified "2006-10-16 12:40:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:65 name: Succinyl:2H(4) def: "Succinic anhydride labeling reagent, heavy form (+4amu, 4H2), N-term & K." [PMID:11857757, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=65] xref: record_id "65" xref: delta_mono_mass "104.041151" xref: delta_avge_mass "104.0974" xref: delta_composition "2H(4) C(4) O(3)" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:19:51" xref: date_time_modified "2006-10-16 12:42:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:66 name: Succinyl:13C(4) def: "Succinic anhydride labeling reagent, heavy form (+4amu, 4C13), N-term & K." [PMID:11857757, PMID:12175151, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=66] xref: record_id "66" xref: delta_mono_mass "104.029463" xref: delta_avge_mass "104.0434" xref: delta_composition "H(4) 13C(4) O(3)" xref: username_of_poster "penner" xref: group_of_poster "users" xref: date_time_posted "2002-10-16 17:23:58" xref: date_time_modified "2006-10-16 12:41:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:89 name: Iminobiotin def: "Iminobiotinylation." [PMID:9750125, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=89] xref: record_id "89" xref: delta_mono_mass "225.093583" xref: delta_avge_mass "225.3106" xref: delta_composition "H(15) C(10) N(3) O S" xref: username_of_poster "toppolzer" xref: group_of_poster "users" xref: date_time_posted "2002-11-25 16:01:48" xref: date_time_modified "2006-10-16 15:26:37" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:90 name: ESP def: "ESP-Tag light d0." [URL:http\://www.wzw.tum.de/proteomik/forum2003/Posters-Abstracts.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=90] xref: record_id "90" xref: delta_mono_mass "338.177647" xref: delta_avge_mass "338.4682" xref: delta_composition "H(26) C(16) N(4) O(2) S" xref: username_of_poster "toppolzer" xref: group_of_poster "users" xref: date_time_posted "2002-11-25 16:12:50" xref: date_time_modified "2006-10-16 15:58:19" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:91 name: ESP:2H(10) def: "ESP-Tag heavy d10." [URL:http\://www.wzw.tum.de/proteomik/forum2003/Posters-Abstracts.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=91] xref: record_id "91" xref: delta_mono_mass "348.240414" xref: delta_avge_mass "348.5299" xref: delta_composition "H(16) 2H(10) C(16) N(4) O(2) S" xref: username_of_poster "toppolzer" xref: group_of_poster "users" xref: date_time_posted "2002-11-25 16:18:58" xref: date_time_modified "2006-10-16 16:03:06" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:92 name: NHS-LC-Biotin def: "NHS-LC-Biotin." [URL:http\://pubs.acs.org/doi/abs/10.1021/bi062142x, URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=8D38BA83-EFDC-421A-853F-E96EBA380612, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=92] synonym: "N-biotinyl-6-aminohexanoyl" [] xref: record_id "92" xref: delta_mono_mass "339.161662" xref: delta_avge_mass "339.453" xref: delta_composition "H(25) C(16) N(3) O(3) S" xref: username_of_poster "toppolzer" xref: group_of_poster "users" xref: date_time_posted "2002-12-04 09:55:19" xref: date_time_modified "2015-05-07 10:57:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:93 name: EDT-maleimide-PEO-biotin def: "EDT-maleimide-PEO-biotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031005, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=93] xref: record_id "93" xref: delta_mono_mass "601.206246" xref: delta_avge_mass "601.8021" xref: delta_composition "H(39) C(25) N(5) O(6) S(3)" xref: username_of_poster "take" xref: group_of_poster "users" xref: date_time_posted "2002-12-27 09:08:56" xref: date_time_modified "2006-11-14 11:15:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:94 name: IMID def: "IMID d0." [PMID:11746907, URL:http\://www.chem.agilent.com/cag/lystag.asp, URL:http\://www.chem.agilent.com/cag/other/IMTHUPO2003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=94] synonym: "2-methoxy-4,5-dihydro-1H-imidazole derivative Lys imidazole" [] xref: record_id "94" xref: delta_mono_mass "68.037448" xref: delta_avge_mass "68.0773" xref: delta_composition "H(4) C(3) N(2)" xref: username_of_poster "Liao" xref: group_of_poster "users" xref: date_time_posted "2003-01-09 04:14:06" xref: date_time_modified "2006-10-16 10:33:45" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:95 name: IMID:2H(4) def: "IMID d4." [URL:http\://www.chem.agilent.com/cag/lystag.asp, PMID:11746907, URL:http\://www.chem.agilent.com/cag/other/IMTHUPO2003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=95] synonym: "2-methoxy-4,5-dihydro-1H-imidazole derivative" [] xref: record_id "95" xref: delta_mono_mass "72.062555" xref: delta_avge_mass "72.1019" xref: delta_composition "2H(4) C(3) N(2)" xref: username_of_poster "Liao" xref: group_of_poster "users" xref: date_time_posted "2003-01-09 04:15:25" xref: date_time_modified "2006-10-16 11:06:13" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:97 name: Propionamide:2H(3) def: "Acrylamide d3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=97] xref: record_id "97" xref: delta_mono_mass "74.055944" xref: delta_avge_mass "74.0964" xref: delta_composition "H(2) 2H(3) C(3) N O" xref: username_of_poster "Liao" xref: group_of_poster "users" xref: date_time_posted "2003-01-14 08:10:30" xref: date_time_modified "2006-10-16 11:07:07" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:105 name: ICAT-C def: "Applied Biosystems cleavable ICAT(TM) light." [URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/icat.htm, URL:https\://products.appliedbiosystems.com/ab/en/US/adirect/ab?cmd=catNavigate2&catID=600902, URL:http\://docs.appliedbiosystems.com/pebiodocs/04333373.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=105] xref: record_id "105" xref: delta_mono_mass "227.126991" xref: delta_avge_mass "227.2603" xref: delta_composition "H(17) C(10) N(3) O(3)" xref: username_of_poster "tpjd2" xref: group_of_poster "users" xref: date_time_posted "2003-01-27 10:27:11" xref: date_time_modified "2006-10-16 15:32:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:106 name: ICAT-C:13C(9) def: "Applied Biosystems cleavable ICAT(TM) heavy." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04333373.pdf, URL:https\://products.appliedbiosystems.com/ab/en/US/adirect/ab?cmd=catNavigate2&catID=600902, URL:http\://www.chemsoc.org/exemplarchem/entries/2002/proteomics/icat.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=106] xref: record_id "106" xref: delta_mono_mass "236.157185" xref: delta_avge_mass "236.1942" xref: delta_composition "H(17) C 13C(9) N(3) O(3)" xref: username_of_poster "tpjd2" xref: group_of_poster "users" xref: date_time_posted "2003-01-27 10:32:53" xref: date_time_modified "2006-10-16 15:34:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:107 name: FormylMet def: "Addition of N-formyl met." [RESID:AA0021, PMID:10825024, PMID:8758896, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=107] xref: record_id "107" xref: delta_mono_mass "159.035399" xref: delta_avge_mass "159.2062" xref: delta_composition "H(9) C(6) N O(2) S" xref: username_of_poster "jphilip" xref: group_of_poster "users" xref: date_time_posted "2003-01-27 18:24:14" xref: date_time_modified "2006-10-16 14:08:15" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Pre-translational" xref: spec_1_misc_notes "only with Listeria monocytogenes (gram-positive bacteria)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:108 name: Nethylmaleimide def: "N-ethylmaleimide on cysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=108] synonym: "CysNEM" [] xref: record_id "108" xref: delta_mono_mass "125.047679" xref: delta_avge_mass "125.1253" xref: delta_composition "H(7) C(6) N O(2)" xref: username_of_poster "Pflieger" xref: group_of_poster "users" xref: date_time_posted "2003-01-30 09:52:51" xref: date_time_modified "2006-10-16 13:36:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:112 name: OxLysBiotinRed def: "Oxidized lysine biotinylated with biotin-LC-hydrazide, reduced." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=112] xref: record_id "112" xref: delta_mono_mass "354.172562" xref: delta_avge_mass "354.4676" xref: delta_composition "H(26) C(16) N(4) O(3) S" xref: username_of_poster "S_Lee" xref: group_of_poster "users" xref: date_time_posted "2003-02-21 00:53:43" xref: date_time_modified "2006-11-14 12:10:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:113 name: OxLysBiotin def: "Oxidized lysine biotinylated with biotin-LC-hydrazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=113] xref: record_id "113" xref: delta_mono_mass "352.156911" xref: delta_avge_mass "352.4518" xref: delta_composition "H(24) C(16) N(4) O(3) S" xref: username_of_poster "S_Lee" xref: group_of_poster "users" xref: date_time_posted "2003-02-21 01:25:11" xref: date_time_modified "2006-11-14 12:10:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:114 name: OxProBiotinRed def: "Oxidized proline biotinylated with biotin-LC-hydrazide, reduced." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=114] xref: record_id "114" xref: delta_mono_mass "371.199111" xref: delta_avge_mass "371.4982" xref: delta_composition "H(29) C(16) N(5) O(3) S" xref: username_of_poster "S_Lee" xref: group_of_poster "users" xref: date_time_posted "2003-02-21 01:34:28" xref: date_time_modified "2006-11-14 12:11:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:115 name: OxProBiotin def: "Oxidized Proline biotinylated with biotin-LC-hydrazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=115] xref: record_id "115" xref: delta_mono_mass "369.183461" xref: delta_avge_mass "369.4823" xref: delta_composition "H(27) C(16) N(5) O(3) S" xref: username_of_poster "S_Lee" xref: group_of_poster "users" xref: date_time_posted "2003-02-21 01:35:44" xref: date_time_modified "2006-11-14 12:11:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:116 name: OxArgBiotin def: "Oxidized arginine biotinylated with biotin-LC-hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://themedicalbiochemistrypage.org/nitrogen-metabolism.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=116] xref: record_id "116" xref: delta_mono_mass "310.135113" xref: delta_avge_mass "310.4118" xref: delta_composition "H(22) C(15) N(2) O(3) S" xref: username_of_poster "S_Lee" xref: group_of_poster "users" xref: date_time_posted "2003-02-21 01:41:19" xref: date_time_modified "2011-07-18 11:34:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:117 name: OxArgBiotinRed def: "Oxidized arginine biotinylated with biotin-LC-hydrazide, reduced." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, URL:http\://themedicalbiochemistrypage.org/nitrogen-metabolism.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=117] xref: record_id "117" xref: delta_mono_mass "312.150763" xref: delta_avge_mass "312.4277" xref: delta_composition "H(24) C(15) N(2) O(3) S" xref: username_of_poster "S_Lee" xref: group_of_poster "users" xref: date_time_posted "2003-02-21 01:43:00" xref: date_time_modified "2011-07-18 11:33:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:118 name: EDT-iodoacetyl-PEO-biotin def: "EDT-iodo-PEO-biotin." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=118] xref: record_id "118" xref: delta_mono_mass "490.174218" xref: delta_avge_mass "490.7034" xref: delta_composition "H(34) C(20) N(4) O(4) S(3)" xref: username_of_poster "take" xref: group_of_poster "users" xref: date_time_posted "2003-02-24 07:18:42" xref: date_time_modified "2006-10-16 17:01:15" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:119 name: IBTP def: "Thio Ether Formation - BTP Adduct." [PMID:11861642, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=119] xref: record_id "119" xref: delta_mono_mass "316.138088" xref: delta_avge_mass "316.3759" xref: delta_composition "H(21) C(22) P" xref: username_of_poster "MRCDunn" xref: group_of_poster "users" xref: date_time_posted "2003-03-13 09:36:40" xref: date_time_modified "2006-10-16 15:52:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:121 name: GG def: "Ubiquitinylation residue." [PMID:12872131, URL:http\://www.nottingham.ac.uk/biochemcourses/students/ub/ubindex.html, PMID:15055197, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=121] comment: The two glycine residues left on ubiquitinylated lysine after tryptic digestion. synonym: "glycineglycine" [] xref: record_id "121" xref: delta_mono_mass "114.042927" xref: delta_avge_mass "114.1026" xref: delta_composition "H(6) C(4) N(2) O(2)" xref: username_of_poster "gielbert" xref: group_of_poster "users" xref: date_time_posted "2003-04-30 13:32:37" xref: date_time_modified "2017-03-06 08:47:05" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "C" xref: spec_4_position "Anywhere" xref: spec_4_classification "Other" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:122 name: Formyl def: "Formylation." [RESID:AA0211, PMID:15799070, RESID:AA0021, FindMod:FORM, RESID:AA0384, RESID:AA0057, RESID:AA0384, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=122] xref: record_id "122" xref: delta_mono_mass "27.994915" xref: delta_avge_mass "28.0101" xref: delta_composition "C O" xref: username_of_poster "pnacman" xref: group_of_poster "users" xref: date_time_posted "2003-05-01 13:28:36" xref: date_time_modified "2006-11-14 12:01:57" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Artefact" xref: spec_2_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" xref: spec_3_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" xref: spec_4_misc_notes "Can occur under CNBr cleavage conditions (70% HCOOH)" xref: spec_5_group "5" xref: spec_5_hidden "0" xref: spec_5_site "N-term" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Post-translational" xref: spec_5_misc_notes "A protein in which either the N-terminal N-formylmethionine has not been processed by the methionyl-tRNA formyltransferase or which is posttranslationally modified by the attachment of at least one formyl group." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:123 name: ICAT-H def: "N-iodoacetyl, p-chlorobenzyl-12C6-glucamine." [PMID:12185208, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=123] synonym: "Harbury glyco-ICAT C12" [] xref: record_id "123" xref: delta_mono_mass "345.097915" xref: delta_avge_mass "345.7754" xref: delta_composition "H(20) C(15) N O(6) Cl" xref: username_of_poster "allis" xref: group_of_poster "users" xref: date_time_posted "2003-05-07 19:54:20" xref: date_time_modified "2006-10-16 16:02:00" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:124 name: ICAT-H:13C(6) def: "N-iodoacetyl, p-chlorobenzyl-13C6-glucamine." [PMID:12185208, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=124] synonym: "Harbury glyco-ICAT C13" [] xref: record_id "124" xref: delta_mono_mass "351.118044" xref: delta_avge_mass "351.7313" xref: delta_composition "H(20) C(9) 13C(6) N O(6) Cl" xref: username_of_poster "allis" xref: group_of_poster "users" xref: date_time_posted "2003-05-07 19:56:12" xref: date_time_modified "2006-10-16 16:04:02" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:126 name: Xlink:DTSSP[88] def: "Cleaved and reduced DSP/DTSSP crosslinker." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, PMID:322714, PMID:3155470, PMID:957432, PMID:8457554, PMID:11710128, PMID:1262347, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=126] comment: Can also be the product of reaction with EZ-Link Sulfo-NHS-SS-Biotin (Sulfosuccinimidyl 2-(biotinamido)-ethyl-1, 3-dithiopropionate) followed by reduction with DTT. synonym: "(Was Thioacyl)" [] xref: record_id "126" xref: delta_mono_mass "87.998285" xref: delta_avge_mass "88.1283" xref: delta_composition "H(4) C(3) O S" xref: username_of_poster "rabah" xref: group_of_poster "users" xref: date_time_posted "2003-06-05 13:38:19" xref: date_time_modified "2017-08-18 17:03:05" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:127 name: Fluoro def: "Fluorination." [PMID:1093385, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=127] xref: record_id "127" xref: delta_mono_mass "17.990578" xref: delta_avge_mass "17.9905" xref: delta_composition "H(-1) F" xref: username_of_poster "jschulte" xref: group_of_poster "users" xref: date_time_posted "2003-06-19 19:54:25" xref: date_time_modified "2012-11-20 11:56:44" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Non-standard residue" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Non-standard residue" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "A" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:128 name: Fluorescein def: "5-Iodoacetamidofluorescein (Molecular Probe, Eugene, OR)." [PMID:3578767, PMID:3311742, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=128] xref: record_id "128" xref: delta_mono_mass "387.074287" xref: delta_avge_mass "387.3417" xref: delta_composition "H(13) C(22) N O(6)" xref: username_of_poster "Philip" xref: group_of_poster "users" xref: date_time_posted "2003-06-25 02:58:18" xref: date_time_modified "2017-11-01 12:11:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:129 name: Iodo def: "Iodination." [PMID:2026710, PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=129] xref: record_id "129" xref: delta_mono_mass "125.896648" xref: delta_avge_mass "125.8965" xref: delta_composition "H(-1) I" xref: username_of_poster "brettsp" xref: group_of_poster "users" xref: date_time_posted "2003-07-10 15:43:17" xref: date_time_modified "2006-10-16 13:38:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:130 name: Diiodo def: "Di-Iodination." [PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=130] xref: record_id "130" xref: delta_mono_mass "251.793296" xref: delta_avge_mass "251.7931" xref: delta_composition "H(-2) I(2)" xref: username_of_poster "brettsp" xref: group_of_poster "users" xref: date_time_posted "2003-07-10 15:49:42" xref: date_time_modified "2011-11-21 13:23:20" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:131 name: Triiodo def: "Tri-Iodination." [PMID:2026710, PMID:15627961, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=131] xref: record_id "131" xref: delta_mono_mass "377.689944" xref: delta_avge_mass "377.6896" xref: delta_composition "H(-3) I(3)" xref: username_of_poster "brettsp" xref: group_of_poster "users" xref: date_time_posted "2003-07-10 15:51:32" xref: date_time_modified "2006-10-16 16:36:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:134 name: Myristoleyl def: "(cis-delta 5)-tetradecaenoyl." [PMID:1326520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=134] comment: Found on vision signal transduction proteins. synonym: "myristoyl with one double bond C14:1 acylation" [] xref: record_id "134" xref: delta_mono_mass "208.182715" xref: delta_avge_mass "208.3398" xref: delta_composition "H(24) C(14) O" xref: username_of_poster "tomneubert" xref: group_of_poster "users" xref: date_time_posted "2003-07-18 21:30:51" xref: date_time_modified "2006-10-16 15:11:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Co-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:135 name: Myristoyl+Delta:H(-4) def: "(cis,cis-delta 5, delta 8)-tetradecadienoyl." [PMID:1326520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=135] comment: Found on vision signal transduction proteins. synonym: "myristoyl with 2 double bonds C14:2 fatty acylation" [] xref: record_id "135" xref: delta_mono_mass "206.167065" xref: delta_avge_mass "206.3239" xref: delta_composition "H(22) C(14) O" xref: username_of_poster "tomneubert" xref: group_of_poster "users" xref: date_time_posted "2003-07-18 21:36:44" xref: date_time_modified "2006-10-16 15:10:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Co-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:136 name: Benzoyl def: "Labeling reagent light form (N-term & K)." [PMID:15456300, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=136] xref: record_id "136" xref: delta_mono_mass "104.026215" xref: delta_avge_mass "104.1061" xref: delta_composition "H(4) C(7) O" xref: username_of_poster "samirjulka" xref: group_of_poster "users" xref: date_time_posted "2003-07-31 22:24:05" xref: date_time_modified "2006-10-16 12:41:22" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:137 name: Hex(5)HexNAc(2) def: "M5/Man5." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=137] comment: Core structure of high-mannose N-linked oligosaccharides. synonym: "N-linked glycan core" [] xref: record_id "137" xref: delta_mono_mass "1216.422863" xref: delta_avge_mass "1217.088" xref: delta_composition "Hex(5) HexNAc(2)" xref: username_of_poster "tpjd2" xref: group_of_poster "users" xref: date_time_posted "2003-08-06 11:31:37" xref: date_time_modified "2020-08-02 11:50:32" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1217_mono_mass "1216.422863" xref: spec_1_neutral_loss_1217_avge_mass "1217.088" xref: spec_1_neutral_loss_1217_flag "false" xref: spec_1_neutral_loss_1217_composition "Hex(5) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:139 name: Dansyl def: "5-dimethylaminonaphthalene-1-sulfonyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=139] xref: record_id "139" xref: delta_mono_mass "233.051049" xref: delta_avge_mass "233.2862" xref: delta_composition "H(11) C(12) N O(2) S" xref: username_of_poster "allis" xref: group_of_poster "users" xref: date_time_posted "2003-08-19 02:51:24" xref: date_time_modified "2006-10-16 15:36:09" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:140 name: a-type-ion def: "ISD a-series (C-Term)." [PMID:14588022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=140] comment: MS/MS experiments of mass spectrometric a-ions (MS^3) can be used for protein identification by library searching. T3-sequencing is such a technique (see reference). Search engines must recognize this \'virtual modification\' for this purpose. synonym: "Decarboxylation of C-terminus as reaction inside the mass spectrometer" [] xref: record_id "140" xref: delta_mono_mass "-46.005479" xref: delta_avge_mass "-46.0254" xref: delta_composition "H(-2) C(-1) O(-2)" xref: username_of_poster "suckau" xref: group_of_poster "users" xref: date_time_posted "2003-09-02 16:17:09" xref: date_time_modified "2010-06-08 14:19:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Other" xref: spec_1_misc_notes "Virtual Modification for MS/MS of a-type ions corrected by subtraction of a further -O at 8.6.2010" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:141 name: Amidine def: "Amidination of lysines or N-terminal amines with methyl acetimidate." [URL:http\://www.indiana.edu/~reillyjp/ASMS2004/janecki_Ext-Abs%20Amidination.pdf, PMID:12643539, PMID:6273432, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=141] xref: record_id "141" xref: delta_mono_mass "41.026549" xref: delta_avge_mass "41.0519" xref: delta_composition "H(3) C(2) N" xref: username_of_poster "pnacman" xref: group_of_poster "users" xref: date_time_posted "2003-09-25 11:04:41" xref: date_time_modified "2006-10-15 18:32:25" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:142 name: HexNAc(1)dHex(1) def: "HexNAc1dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=142] xref: record_id "142" xref: delta_mono_mass "349.137281" xref: delta_avge_mass "349.3337" xref: delta_composition "dHex HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:28:45" xref: date_time_modified "2015-05-05 10:49:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_350_mono_mass "349.137281" xref: spec_1_neutral_loss_350_avge_mass "349.3337" xref: spec_1_neutral_loss_350_flag "false" xref: spec_1_neutral_loss_350_composition "dHex HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_350_mono_mass "349.137281" xref: spec_2_neutral_loss_350_avge_mass "349.3337" xref: spec_2_neutral_loss_350_flag "false" xref: spec_2_neutral_loss_350_composition "dHex HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_350_mono_mass "349.137281" xref: spec_2_neutral_loss_350_avge_mass "349.3337" xref: spec_2_neutral_loss_350_flag "false" xref: spec_2_neutral_loss_350_composition "dHex HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:143 name: HexNAc(2) def: "HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=143] xref: record_id "143" xref: delta_mono_mass "406.158745" xref: delta_avge_mass "406.385" xref: delta_composition "HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:37:55" xref: date_time_modified "2015-05-05 10:50:08" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_407_mono_mass "406.158745" xref: spec_1_neutral_loss_407_avge_mass "406.385" xref: spec_1_neutral_loss_407_flag "false" xref: spec_1_neutral_loss_407_composition "HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_407_mono_mass "406.158745" xref: spec_2_neutral_loss_407_avge_mass "406.385" xref: spec_2_neutral_loss_407_flag "false" xref: spec_2_neutral_loss_407_composition "HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_407_mono_mass "406.158745" xref: spec_2_neutral_loss_407_avge_mass "406.385" xref: spec_2_neutral_loss_407_flag "false" xref: spec_2_neutral_loss_407_composition "HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:144 name: Hex(3) def: "Hex3." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=144] xref: record_id "144" xref: delta_mono_mass "486.158471" xref: delta_avge_mass "486.4218" xref: delta_composition "Hex(3)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:39:30" xref: date_time_modified "2015-05-05 10:52:04" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_487_mono_mass "486.158471" xref: spec_1_neutral_loss_487_avge_mass "486.4218" xref: spec_1_neutral_loss_487_flag "false" xref: spec_1_neutral_loss_487_composition "Hex(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_487_mono_mass "486.158471" xref: spec_2_neutral_loss_487_avge_mass "486.4218" xref: spec_2_neutral_loss_487_flag "false" xref: spec_2_neutral_loss_487_composition "Hex(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_487_mono_mass "486.158471" xref: spec_2_neutral_loss_487_avge_mass "486.4218" xref: spec_2_neutral_loss_487_flag "false" xref: spec_2_neutral_loss_487_composition "Hex(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:145 name: HexNAc(1)dHex(2) def: "HexNAc1dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=145] xref: record_id "145" xref: delta_mono_mass "495.19519" xref: delta_avge_mass "495.4749" xref: delta_composition "dHex(2) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:40:57" xref: date_time_modified "2015-05-01 15:19:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_496_mono_mass "495.19519" xref: spec_1_neutral_loss_496_avge_mass "495.4749" xref: spec_1_neutral_loss_496_flag "false" xref: spec_1_neutral_loss_496_composition "dHex(2) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:146 name: Hex(1)HexNAc(1)dHex(1) def: "Hex1HexNAc1dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=146] xref: record_id "146" xref: delta_mono_mass "511.190105" xref: delta_avge_mass "511.4743" xref: delta_composition "dHex Hex HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:42:27" xref: date_time_modified "2015-05-05 10:52:59" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_512_mono_mass "511.190105" xref: spec_1_neutral_loss_512_avge_mass "511.4743" xref: spec_1_neutral_loss_512_flag "false" xref: spec_1_neutral_loss_512_composition "dHex Hex HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_512_mono_mass "511.190105" xref: spec_2_neutral_loss_512_avge_mass "511.4743" xref: spec_2_neutral_loss_512_flag "false" xref: spec_2_neutral_loss_512_composition "dHex Hex HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_512_mono_mass "511.190105" xref: spec_2_neutral_loss_512_avge_mass "511.4743" xref: spec_2_neutral_loss_512_flag "false" xref: spec_2_neutral_loss_512_composition "dHex Hex HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:147 name: HexNAc(2)dHex(1) def: "HexNAc2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=147] xref: record_id "147" xref: delta_mono_mass "552.216654" xref: delta_avge_mass "552.5262" xref: delta_composition "dHex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:44:18" xref: date_time_modified "2015-05-01 15:23:32" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_553_mono_mass "552.216654" xref: spec_1_neutral_loss_553_avge_mass "552.5262" xref: spec_1_neutral_loss_553_flag "false" xref: spec_1_neutral_loss_553_composition "dHex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:148 name: Hex(1)HexNAc(2) def: "Hex1HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=148] xref: record_id "148" xref: delta_mono_mass "568.211569" xref: delta_avge_mass "568.5256" xref: delta_composition "Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:48:18" xref: date_time_modified "2015-05-05 10:46:08" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_569_mono_mass "568.211569" xref: spec_1_neutral_loss_569_avge_mass "568.5256" xref: spec_1_neutral_loss_569_flag "false" xref: spec_1_neutral_loss_569_composition "Hex HexNAc(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_569_mono_mass "568.211569" xref: spec_2_neutral_loss_569_avge_mass "568.5256" xref: spec_2_neutral_loss_569_flag "false" xref: spec_2_neutral_loss_569_composition "Hex HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_569_mono_mass "568.211569" xref: spec_2_neutral_loss_569_avge_mass "568.5256" xref: spec_2_neutral_loss_569_flag "false" xref: spec_2_neutral_loss_569_composition "Hex HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:149 name: Hex(1)HexNAc(1)NeuAc(1) def: "Hex1HexNAc1NeuAc1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=149] xref: record_id "149" xref: delta_mono_mass "656.227613" xref: delta_avge_mass "656.5877" xref: delta_composition "Hex HexNAc NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:51:19" xref: date_time_modified "2015-05-01 15:25:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_657_mono_mass "656.227613" xref: spec_1_neutral_loss_657_avge_mass "656.5877" xref: spec_1_neutral_loss_657_flag "false" xref: spec_1_neutral_loss_657_composition "Hex HexNAc NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_657_mono_mass "656.227613" xref: spec_2_neutral_loss_657_avge_mass "656.5877" xref: spec_2_neutral_loss_657_flag "false" xref: spec_2_neutral_loss_657_composition "Hex HexNAc NeuAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_657_mono_mass "656.227613" xref: spec_2_neutral_loss_657_avge_mass "656.5877" xref: spec_2_neutral_loss_657_flag "false" xref: spec_2_neutral_loss_657_composition "Hex HexNAc NeuAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:150 name: HexNAc(2)dHex(2) def: "HexNAc2dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=150] xref: record_id "150" xref: delta_mono_mass "698.274563" xref: delta_avge_mass "698.6674" xref: delta_composition "dHex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:52:36" xref: date_time_modified "2015-05-01 15:25:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_699_mono_mass "698.274563" xref: spec_1_neutral_loss_699_avge_mass "698.6674" xref: spec_1_neutral_loss_699_flag "false" xref: spec_1_neutral_loss_699_composition "dHex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:151 name: Hex(1)HexNAc(2)Pent(1) def: "Hex1HexNAc2Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=151] xref: record_id "151" xref: delta_mono_mass "700.253828" xref: delta_avge_mass "700.6403" xref: delta_composition "Pent Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:53:29" xref: date_time_modified "2015-05-01 15:26:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_701_mono_mass "700.253828" xref: spec_1_neutral_loss_701_avge_mass "700.6403" xref: spec_1_neutral_loss_701_flag "false" xref: spec_1_neutral_loss_701_composition "Pent Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:152 name: Hex(1)HexNAc(2)dHex(1) def: "Hex1HexNAc2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=152] xref: record_id "152" xref: delta_mono_mass "714.269478" xref: delta_avge_mass "714.6668" xref: delta_composition "dHex Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:54:18" xref: date_time_modified "2015-05-05 16:20:33" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_715_mono_mass "714.269478" xref: spec_1_neutral_loss_715_avge_mass "714.6668" xref: spec_1_neutral_loss_715_flag "false" xref: spec_1_neutral_loss_715_composition "dHex Hex HexNAc(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_715_mono_mass "714.269478" xref: spec_2_neutral_loss_715_avge_mass "714.6668" xref: spec_2_neutral_loss_715_flag "false" xref: spec_2_neutral_loss_715_composition "dHex Hex HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_715_mono_mass "714.269478" xref: spec_2_neutral_loss_715_avge_mass "714.6668" xref: spec_2_neutral_loss_715_flag "false" xref: spec_2_neutral_loss_715_composition "dHex Hex HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:153 name: Hex(2)HexNAc(2) def: "Hex2HexNAc2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=153] xref: record_id "153" xref: delta_mono_mass "730.264392" xref: delta_avge_mass "730.6662" xref: delta_composition "Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:55:08" xref: date_time_modified "2015-05-05 16:22:13" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_731_mono_mass "730.264392" xref: spec_1_neutral_loss_731_avge_mass "730.6662" xref: spec_1_neutral_loss_731_flag "false" xref: spec_1_neutral_loss_731_composition "Hex(2) HexNAc(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_731_mono_mass "730.264392" xref: spec_2_neutral_loss_731_avge_mass "730.6662" xref: spec_2_neutral_loss_731_flag "false" xref: spec_2_neutral_loss_731_composition "Hex(2) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_731_mono_mass "730.264392" xref: spec_2_neutral_loss_731_avge_mass "730.6662" xref: spec_2_neutral_loss_731_flag "false" xref: spec_2_neutral_loss_731_composition "Hex(2) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:154 name: Hex(3)HexNAc(1)Pent(1) def: "Hex3HexNAc1Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=154] xref: record_id "154" xref: delta_mono_mass "821.280102" xref: delta_avge_mass "821.7289" xref: delta_composition "Pent Hex(3) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:56:02" xref: date_time_modified "2015-05-01 15:29:31" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_822_mono_mass "821.280102" xref: spec_1_neutral_loss_822_avge_mass "821.7289" xref: spec_1_neutral_loss_822_flag "false" xref: spec_1_neutral_loss_822_composition "Pent Hex(3) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:155 name: Hex(1)HexNAc(2)dHex(1)Pent(1) def: "Hex1HexNAc2dHex1Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&dhex=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=155] xref: record_id "155" xref: delta_mono_mass "846.311736" xref: delta_avge_mass "846.7815" xref: delta_composition "Pent dHex Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:57:01" xref: date_time_modified "2015-05-01 15:29:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_847_mono_mass "846.311736" xref: spec_1_neutral_loss_847_avge_mass "846.7815" xref: spec_1_neutral_loss_847_flag "false" xref: spec_1_neutral_loss_847_composition "Pent dHex Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:156 name: Hex(1)HexNAc(2)dHex(2) def: "Hex1HexNAc2dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=156] xref: record_id "156" xref: delta_mono_mass "860.327386" xref: delta_avge_mass "860.808" xref: delta_composition "dHex(2) Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:57:52" xref: date_time_modified "2015-05-05 16:24:22" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_861_mono_mass "860.327386" xref: spec_1_neutral_loss_861_avge_mass "860.808" xref: spec_1_neutral_loss_861_flag "false" xref: spec_1_neutral_loss_861_composition "dHex(2) Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_861_mono_mass "860.327386" xref: spec_2_neutral_loss_861_avge_mass "860.808" xref: spec_2_neutral_loss_861_flag "false" xref: spec_2_neutral_loss_861_composition "dHex(2) Hex HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_861_mono_mass "860.327386" xref: spec_2_neutral_loss_861_avge_mass "860.808" xref: spec_2_neutral_loss_861_flag "false" xref: spec_2_neutral_loss_861_composition "dHex(2) Hex HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:157 name: Hex(2)HexNAc(2)Pent(1) def: "Hex2HexNAc2Pent1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=157] xref: record_id "157" xref: delta_mono_mass "862.306651" xref: delta_avge_mass "862.7809" xref: delta_composition "Pent Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:58:38" xref: date_time_modified "2015-05-01 15:30:54" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_863_mono_mass "862.306651" xref: spec_1_neutral_loss_863_avge_mass "862.7809" xref: spec_1_neutral_loss_863_flag "false" xref: spec_1_neutral_loss_863_composition "Pent Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:158 name: Hex(2)HexNAc(2)dHex(1) def: "Hex2HexNAc2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=158] xref: record_id "158" xref: delta_mono_mass "876.322301" xref: delta_avge_mass "876.8074" xref: delta_composition "dHex Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:59:18" xref: date_time_modified "2015-05-05 16:26:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_877_mono_mass "876.322301" xref: spec_1_neutral_loss_877_avge_mass "876.8074" xref: spec_1_neutral_loss_877_flag "false" xref: spec_1_neutral_loss_877_composition "dHex Hex(2) HexNAc(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_877_mono_mass "876.322301" xref: spec_2_neutral_loss_877_avge_mass "876.8074" xref: spec_2_neutral_loss_877_flag "false" xref: spec_2_neutral_loss_877_composition "dHex Hex(2) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_877_mono_mass "876.322301" xref: spec_2_neutral_loss_877_avge_mass "876.8074" xref: spec_2_neutral_loss_877_flag "false" xref: spec_2_neutral_loss_877_composition "dHex Hex(2) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:159 name: Hex(3)HexNAc(2) def: "M3/Man3." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=159] synonym: "chitobiose core" [] xref: record_id "159" xref: delta_mono_mass "892.317216" xref: delta_avge_mass "892.8068" xref: delta_composition "Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 12:59:59" xref: date_time_modified "2020-08-02 11:51:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_893_mono_mass "892.317216" xref: spec_1_neutral_loss_893_avge_mass "892.8068" xref: spec_1_neutral_loss_893_flag "false" xref: spec_1_neutral_loss_893_composition "Hex(3) HexNAc(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_893_mono_mass "892.317216" xref: spec_2_neutral_loss_893_avge_mass "892.8068" xref: spec_2_neutral_loss_893_flag "false" xref: spec_2_neutral_loss_893_composition "Hex(3) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_893_mono_mass "892.317216" xref: spec_2_neutral_loss_893_avge_mass "892.8068" xref: spec_2_neutral_loss_893_flag "false" xref: spec_2_neutral_loss_893_composition "Hex(3) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:160 name: Hex(1)HexNAc(1)NeuAc(2) def: "Hex HexNAc NeuAc(2) ---OR--- Hex HexNAc(3) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=160] xref: record_id "160" xref: delta_mono_mass "947.323029" xref: delta_avge_mass "947.8423" xref: delta_composition "Hex HexNAc NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 13:01:06" xref: date_time_modified "2017-11-17 11:43:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_948_mono_mass "947.323029" xref: spec_1_neutral_loss_948_avge_mass "947.8423" xref: spec_1_neutral_loss_948_flag "false" xref: spec_1_neutral_loss_948_composition "Hex HexNAc NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_948_mono_mass "947.323029" xref: spec_2_neutral_loss_948_avge_mass "947.8423" xref: spec_2_neutral_loss_948_flag "false" xref: spec_2_neutral_loss_948_composition "Hex HexNAc NeuAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_948_mono_mass "947.323029" xref: spec_2_neutral_loss_948_avge_mass "947.8423" xref: spec_2_neutral_loss_948_flag "false" xref: spec_2_neutral_loss_948_composition "Hex HexNAc NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:161 name: Hex(3)HexNAc(2)Phos(1) def: "Hex(3) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=161] xref: record_id "161" xref: delta_mono_mass "972.283547" xref: delta_avge_mass "972.7867" xref: delta_composition "H O(3) P Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2003-09-29 13:02:02" xref: date_time_modified "2015-05-06 09:48:32" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_973_mono_mass "972.283547" xref: spec_1_neutral_loss_973_avge_mass "972.7867" xref: spec_1_neutral_loss_973_flag "false" xref: spec_1_neutral_loss_973_composition "H O(3) P Hex(3) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:162 name: Delta:S(-1)Se(1) def: "Selenium replaces sulfur." [RESID:AA0022, PMID:12148805, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=162] xref: record_id "162" xref: delta_mono_mass "47.944449" xref: delta_avge_mass "46.895" xref: delta_composition "S(-1) Se" xref: username_of_poster "pnacman" xref: group_of_poster "users" xref: date_time_posted "2003-10-14 11:24:28" xref: date_time_modified "2012-03-09 11:23:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Non-standard residue" xref: spec_2_misc_notes "Selenocysteine conventionally represented by 1 letter code U" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:170 name: Delta:H(1)N(-1)18O(1) def: "Glycosylated asparagine 18O labeling." [PMID:1443554, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=170] comment: Conversion of glycosylated asparagine residues upon deglycosylation with PGNase F in 18O labelled water. xref: record_id "170" xref: delta_mono_mass "2.988261" xref: delta_avge_mass "2.9845" xref: delta_composition "H(-1) N(-1) 18O" xref: username_of_poster "lobvi" xref: group_of_poster "users" xref: date_time_posted "2003-12-11 18:24:58" xref: date_time_modified "2014-05-21 08:59:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:171 name: NBS:13C(6) def: "Shimadzu NBS-13C." [PMID:12845591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=171] synonym: "NBS reagent heavy" [] xref: record_id "171" xref: delta_mono_mass "159.008578" xref: delta_avge_mass "159.1144" xref: delta_composition "H(3) 13C(6) N O(2) S" xref: username_of_poster "kuyama" xref: group_of_poster "users" xref: date_time_posted "2004-01-07 07:22:34" xref: date_time_modified "2007-08-31 10:35:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:172 name: NBS def: "Shimadzu NBS-12C." [PMID:12845591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=172] synonym: "2-nitrobenzenesulfenyl" [] xref: record_id "172" xref: delta_mono_mass "152.988449" xref: delta_avge_mass "153.1585" xref: delta_composition "H(3) C(6) N O(2) S" xref: username_of_poster "kuyama" xref: group_of_poster "users" xref: date_time_posted "2004-01-07 07:25:07" xref: date_time_modified "2007-08-31 10:34:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:176 name: BHT def: "Michael addition of BHT quinone methide to Cysteine and Lysine." [PMID:9448752, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=176] comment: BHT metabolism has been studied in rats and mice in relation to tumor promotion. synonym: "Butylated Hydroxytoluene" [] xref: record_id "176" xref: delta_mono_mass "218.167065" xref: delta_avge_mass "218.3346" xref: delta_composition "H(22) C(15) O" xref: username_of_poster "gonzo" xref: group_of_poster "users" xref: date_time_posted "2004-02-05 22:02:53" xref: date_time_modified "2006-10-16 15:19:41" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "Secondary adduct - much less common as C" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_2_misc_notes "Secondary adduct - much less common as C" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other" xref: spec_3_misc_notes "Primary adduct formed" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:178 name: DAET def: "Phosphorylation to amine thiol." [PMID:12216740, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=178] comment: DAET = 2-(dimethylamino)ethanethiol; The phosphorylation to amine is the beta elimination of phosphate and Michael addition of 2-(dimethylamino)ethanethiol to the site. synonym: "b-elimination thiol derivatization" [] xref: record_id "178" xref: delta_mono_mass "87.050655" xref: delta_avge_mass "87.1866" xref: delta_composition "H(9) C(4) N O(-1) S" xref: username_of_poster "chemgirl18" xref: group_of_poster "users" xref: date_time_posted "2004-02-11 20:34:16" xref: date_time_modified "2006-10-16 12:34:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:184 name: Label:13C(9) def: "13C(9) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=184] synonym: "heavy tyrosine" [] xref: record_id "184" xref: delta_mono_mass "9.030193" xref: delta_avge_mass "8.9339" xref: delta_composition "C(-9) 13C(9)" xref: username_of_poster "hs" xref: group_of_poster "users" xref: date_time_posted "2004-02-16 21:19:47" xref: date_time_modified "2007-08-22 18:31:52" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "F" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:185 name: Label:13C(9)+Phospho def: "C13 label (Phosphotyrosine)." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=185] synonym: "heavy phosphotyrosine" [] xref: record_id "185" xref: delta_mono_mass "88.996524" xref: delta_avge_mass "88.9138" xref: delta_composition "H C(-9) 13C(9) O(3) P" xref: username_of_poster "hs" xref: group_of_poster "users" xref: date_time_posted "2004-02-22 04:42:33" xref: date_time_modified "2006-10-16 12:37:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:186 name: HPG def: "Hydroxyphenylglyoxal arginine." [PMID:11698400, PMID:11914093, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=186] synonym: "HPG arginine" [] xref: record_id "186" xref: delta_mono_mass "132.021129" xref: delta_avge_mass "132.1162" xref: delta_composition "H(4) C(8) O(2)" xref: username_of_poster "gcarven" xref: group_of_poster "users" xref: date_time_posted "2004-02-26 20:19:25" xref: date_time_modified "2006-10-17 11:46:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:187 name: 2HPG def: "Bis(hydroxphenylglyoxal) arginine." [PMID:11698400, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=187] comment: OH-PGO and PGO react with arginine at a stoichiometry of 2:1. xref: record_id "187" xref: delta_mono_mass "282.052824" xref: delta_avge_mass "282.2476" xref: delta_composition "H(10) C(16) O(5)" xref: username_of_poster "gcarven" xref: group_of_poster "users" xref: date_time_posted "2004-02-26 22:05:25" xref: date_time_modified "2009-06-26 17:37:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:188 name: Label:13C(6) def: "13C(6) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=188] xref: record_id "188" xref: delta_mono_mass "6.020129" xref: delta_avge_mass "5.9559" xref: delta_composition "C(-6) 13C(6)" xref: username_of_poster "hs" xref: group_of_poster "users" xref: date_time_posted "2004-02-28 19:54:10" xref: date_time_modified "2007-08-22 18:29:56" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "Used in SILAC experiment" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "L" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Used in SILAC experiment" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "I" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "Used in SILAC experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:193 name: Label:18O(2) def: "O18 label at both C-terminal oxygens." [PMID:11467524, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=193] synonym: "Double O18 (C-term)" [] xref: record_id "193" xref: delta_mono_mass "4.008491" xref: delta_avge_mass "3.9995" xref: delta_composition "O(-2) 18O(2)" xref: username_of_poster "Hensbergen" xref: group_of_poster "users" xref: date_time_posted "2004-03-30 14:20:29" xref: date_time_modified "2006-11-14 12:01:04" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:194 name: AccQTag def: "6-aminoquinolyl-N-hydroxysuccinimidyl carbamate." [URL:http\://www2.waters.com/watprod.nsf/newdocs/930494, PMID:14997490, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=194] xref: record_id "194" xref: delta_mono_mass "170.048013" xref: delta_avge_mass "170.1674" xref: delta_composition "H(6) C(10) N(2) O" xref: username_of_poster "davidcreasy" xref: group_of_poster "users" xref: date_time_posted "2004-04-08 12:01:19" xref: date_time_modified "2006-10-16 14:59:12" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:195 name: QAT def: "APTA-d0." [PMID:15283597, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=195] synonym: "(3-acrylamidopropyl)trimethylammonium" [] xref: record_id "195" xref: delta_mono_mass "171.149738" xref: delta_avge_mass "171.26" xref: delta_composition "H(19) C(9) N(2) O" xref: username_of_poster "s_julka" xref: group_of_poster "users" xref: date_time_posted "2004-04-08 17:12:14" xref: date_time_modified "2009-06-26 17:39:29" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:196 name: QAT:2H(3) def: "APTA d3." [PMID:15283597, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=196] synonym: "(3-acrylamidopropyl)trimethylammonium" [] xref: record_id "196" xref: delta_mono_mass "174.168569" xref: delta_avge_mass "174.2784" xref: delta_composition "H(16) 2H(3) C(9) N(2) O" xref: username_of_poster "s_julka" xref: group_of_poster "users" xref: date_time_posted "2004-04-08 17:15:04" xref: date_time_modified "2006-10-16 15:01:35" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:197 name: EQAT def: "EAPTA d0." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=197] xref: record_id "197" xref: delta_mono_mass "184.157563" xref: delta_avge_mass "184.2786" xref: delta_composition "H(20) C(10) N(2) O" xref: username_of_poster "s_julka" xref: group_of_poster "users" xref: date_time_posted "2004-04-08 17:21:08" xref: date_time_modified "2006-10-16 15:05:02" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:198 name: EQAT:2H(5) def: "EAPTA d5." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=198] xref: record_id "198" xref: delta_mono_mass "189.188947" xref: delta_avge_mass "189.3094" xref: delta_composition "H(15) 2H(5) C(10) N(2) O" xref: username_of_poster "s_julka" xref: group_of_poster "users" xref: date_time_posted "2004-04-08 17:25:24" xref: date_time_modified "2006-10-16 15:07:31" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:199 name: Dimethyl:2H(4) def: "DiMethyl-CHD2." [PMID:14670044, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=199] synonym: "reductive amination" [] xref: record_id "199" xref: delta_mono_mass "32.056407" xref: delta_avge_mass "32.0778" xref: delta_composition "2H(4) C(2)" xref: username_of_poster "PhilipHsu" xref: group_of_poster "users" xref: date_time_posted "2004-04-20 07:07:29" xref: date_time_modified "2014-11-16 07:35:30" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "When dimethyl labelling is pre-digest" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:200 name: Ethanedithiol def: "EDT." [PMID:11507762, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=200] xref: record_id "200" xref: delta_mono_mass "75.980527" xref: delta_avge_mass "76.1838" xref: delta_composition "H(4) C(2) O(-1) S(2)" xref: username_of_poster "take" xref: group_of_poster "users" xref: date_time_posted "2004-04-20 08:27:30" xref: date_time_modified "2006-10-16 11:07:38" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:205 name: Delta:H(6)C(6)O(1) def: "Acrolein addition +94." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=205] synonym: "Acrolein94, FDP" [] xref: record_id "205" xref: delta_mono_mass "94.041865" xref: delta_avge_mass "94.1112" xref: delta_composition "H(6) C(6) O" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-05-06 18:54:17" xref: date_time_modified "2006-10-16 12:38:28" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:206 name: Delta:H(4)C(3)O(1) def: "Acrolein addition +56." [PMID:15541752, PMID:10825247, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=206] synonym: "Acrolein56" [] xref: record_id "206" xref: delta_mono_mass "56.026215" xref: delta_avge_mass "56.0633" xref: delta_composition "H(4) C(3) O" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-05-06 18:55:58" xref: date_time_modified "2017-11-08 16:29:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:207 name: Delta:H(2)C(3) def: "Acrolein addition +38." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=207] synonym: "Acrolein38" [] xref: record_id "207" xref: delta_mono_mass "38.01565" xref: delta_avge_mass "38.048" xref: delta_composition "H(2) C(3)" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-05-06 18:57:08" xref: date_time_modified "2006-10-15 18:30:31" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:208 name: Delta:H(4)C(6) def: "Acrolein addition +76." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=208] synonym: "Acrolein76" [] xref: record_id "208" xref: delta_mono_mass "76.0313" xref: delta_avge_mass "76.096" xref: delta_composition "H(4) C(6)" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-05-06 18:59:23" xref: date_time_modified "2006-10-16 11:08:13" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:209 name: Delta:H(8)C(6)O(2) def: "Acrolein addition +112." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=209] synonym: "Acrolein112" [] xref: record_id "209" xref: delta_mono_mass "112.05243" xref: delta_avge_mass "112.1265" xref: delta_composition "H(8) C(6) O(2)" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-05-06 19:00:25" xref: date_time_modified "2006-10-16 12:46:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:211 name: NEIAA def: "N-ethyl iodoacetamide-d0." [PMID:12766232, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=211] xref: record_id "211" xref: delta_mono_mass "85.052764" xref: delta_avge_mass "85.1045" xref: delta_composition "H(7) C(4) N O" xref: username_of_poster "Botting" xref: group_of_poster "users" xref: date_time_posted "2004-05-18 11:10:37" xref: date_time_modified "2006-10-16 12:15:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:212 name: NEIAA:2H(5) def: "N-ethyl iodoacetamide-d5." [PMID:12766232, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=212] xref: record_id "212" xref: delta_mono_mass "90.084148" xref: delta_avge_mass "90.1353" xref: delta_composition "H(2) 2H(5) C(4) N O" xref: username_of_poster "Botting" xref: group_of_poster "users" xref: date_time_posted "2004-05-18 11:11:52" xref: date_time_modified "2006-10-16 12:38:09" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:213 name: ADP-Ribosyl def: "ADP Ribose addition." [URL:http\://betelgeuse.u-strasbg.fr/DocPARP/DocPARG/images/Structure-pADPR.jpg, PMID:15842200, RESID:AA0231, RESID:AA0237, RESID:AA0295, FindMod:ADP, RESID:AA0168, RESID:AA0169, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=213] xref: record_id "213" xref: delta_mono_mass "541.06111" xref: delta_avge_mass "541.3005" xref: delta_composition "H(13) C(10) N(5) O(9) P(2) Pent" xref: username_of_poster "ionjockey" xref: group_of_poster "users" xref: date_time_posted "2004-05-27 20:53:37" xref: date_time_modified "2017-11-23 14:29:45" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other glycosylation" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N" xref: spec_3_position "Anywhere" xref: spec_3_classification "N-linked glycosylation" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_542_mono_mass "541.06111" xref: spec_3_neutral_loss_542_avge_mass "541.3005" xref: spec_3_neutral_loss_542_flag "false" xref: spec_3_neutral_loss_542_composition "H(13) C(10) N(5) O(9) P(2) Pent" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "O-linked glycosylation" xref: spec_4_neutral_loss_542_mono_mass "541.06111" xref: spec_4_neutral_loss_542_avge_mass "541.3005" xref: spec_4_neutral_loss_542_flag "false" xref: spec_4_neutral_loss_542_composition "H(13) C(10) N(5) O(9) P(2) Pent" xref: spec_4_neutral_loss_0_mono_mass "0" xref: spec_4_neutral_loss_0_avge_mass "0" xref: spec_4_neutral_loss_0_flag "false" xref: spec_4_neutral_loss_0_composition "0" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "O-linked glycosylation" xref: spec_4_neutral_loss_0_mono_mass "0" xref: spec_4_neutral_loss_0_avge_mass "0" xref: spec_4_neutral_loss_0_flag "false" xref: spec_4_neutral_loss_0_composition "0" xref: spec_4_neutral_loss_542_mono_mass "541.06111" xref: spec_4_neutral_loss_542_avge_mass "541.3005" xref: spec_4_neutral_loss_542_flag "false" xref: spec_4_neutral_loss_542_composition "H(13) C(10) N(5) O(9) P(2) Pent" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "E" xref: spec_5_position "Anywhere" xref: spec_5_classification "Other glycosylation" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "K" xref: spec_6_position "Anywhere" xref: spec_6_classification "Other glycosylation" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "D" xref: spec_7_position "Anywhere" xref: spec_7_classification "Other glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:214 name: iTRAQ4plex def: "Representative mass and accurate mass for 116 & 117." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=214] comment: Different channels have the same nominal mass but slightly different exact masses. Use this value for all channels for quantitation purposes. mTRAQ heavy is identical to iTRAQ4plex 117. synonym: "AKA iTRAQ4plex116/7 Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" [] xref: record_id "214" xref: delta_mono_mass "144.102063" xref: delta_avge_mass "144.1544" xref: delta_composition "H(12) C(4) 13C(3) N 15N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2004-06-08 14:04:07" xref: date_time_modified "2017-11-09 09:35:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Very low abundance" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "Very low abundance" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_6_misc_notes "Very low abundance" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "N-term" xref: spec_7_position "Protein N-term" xref: spec_7_classification "Isotopic label" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "C" xref: spec_8_position "Anywhere" xref: spec_8_classification "Isotopic label" xref: spec_8_misc_notes "side reaction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:243 name: IGBP def: "Light IDBEST tag for quantitation." [URL:http\://www.targetdiscovery.com/index.php?topic=prod.idbe, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=243] xref: record_id "243" xref: delta_mono_mass "296.016039" xref: delta_avge_mass "297.1478" xref: delta_composition "H(13) C(12) N(2) O(2) Br" xref: username_of_poster "zqiao" xref: group_of_poster "users" xref: date_time_posted "2004-07-26 23:02:04" xref: date_time_modified "2006-10-19 11:13:26" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:253 name: Crotonaldehyde def: "Crotonaldehyde." [PMID:11283024, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=253] xref: record_id "253" xref: delta_mono_mass "70.041865" xref: delta_avge_mass "70.0898" xref: delta_composition "H(6) C(4) O" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-08-12 19:56:03" xref: date_time_modified "2006-10-16 10:35:31" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:254 name: Delta:H(2)C(2) def: "Acetaldehyde +26." [PMID:7744761, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=254] comment: Lys modification is formation of Schiff base. xref: record_id "254" xref: delta_mono_mass "26.01565" xref: delta_avge_mass "26.0373" xref: delta_composition "H(2) C(2)" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-08-12 20:01:03" xref: date_time_modified "2011-11-21 13:14:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Other" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Any N-term" xref: spec_4_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:255 name: Delta:H(4)C(2) def: "Acetaldehyde +28." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=255] comment: Reduction of Schiff base formed between K amino group and acetaldehyde. xref: record_id "255" xref: delta_mono_mass "28.0313" xref: delta_avge_mass "28.0532" xref: delta_composition "H(4) C(2)" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-08-12 20:02:38" xref: date_time_modified "2011-11-21 13:14:58" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:256 name: Delta:H(4)C(3) def: "Propionaldehyde +40." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=256] xref: record_id "256" xref: delta_mono_mass "40.0313" xref: delta_avge_mass "40.0639" xref: delta_composition "H(4) C(3)" xref: username_of_poster "fatcat" xref: group_of_poster "users" xref: date_time_posted "2004-08-12 20:04:01" xref: date_time_modified "2010-02-25 10:49:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:258 name: Label:18O(1) def: "O18 Labeling." [PMID:11467524, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=258] synonym: "H2 18O Alkaline Phosphatase" [] xref: record_id "258" xref: delta_mono_mass "2.004246" xref: delta_avge_mass "1.9998" xref: delta_composition "O(-1) 18O" xref: username_of_poster "chemgirl18" xref: group_of_poster "users" xref: date_time_posted "2004-08-27 21:57:17" xref: date_time_modified "2006-10-13 18:53:41" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "alkaline phosphatase to dephosphorylate" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "alkaline phosphatase to dephosphorylate" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "alkaline phosphatase to dephosphorylate" xref: spec_4_group "4" xref: spec_4_hidden "0" xref: spec_4_site "C-term" xref: spec_4_position "Any C-term" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "digesting in labelled water" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:259 name: Label:13C(6)15N(2) def: "13C(6) 15N(2) Silac label." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=259] synonym: "heavy lysine" [] xref: record_id "259" xref: delta_mono_mass "8.014199" xref: delta_avge_mass "7.9427" xref: delta_composition "C(-6) 13C(6) N(-2) 15N(2)" xref: username_of_poster "hs01" xref: group_of_poster "users" xref: date_time_posted "2004-08-30 16:23:02" xref: date_time_modified "2014-06-09 09:40:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:260 name: Thiophospho def: "Thiophosphorylation." [PMID:12110917, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=260] xref: record_id "260" xref: delta_mono_mass "95.943487" xref: delta_avge_mass "96.0455" xref: delta_composition "H O(2) P S" xref: username_of_poster "mrbladergroen" xref: group_of_poster "users" xref: date_time_posted "2004-09-01 13:20:58" xref: date_time_modified "2006-10-16 12:38:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:261 name: SPITC def: "4-sulfophenyl isothiocyanate." [URL:http\://www.shimadzu-biotech.net/literature/application_note/202_1.pdf, PMID:14745769, PMID:14689565, PMID:16526082, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=261] synonym: "N-terminal / lysine sulfonation" [] xref: record_id "261" xref: delta_mono_mass "214.971084" xref: delta_avge_mass "215.2495" xref: delta_composition "H(5) C(7) N O(3) S(2)" xref: username_of_poster "hatlevig" xref: group_of_poster "users" xref: date_time_posted "2004-09-14 20:01:29" xref: date_time_modified "2006-10-16 15:26:00" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:262 name: Label:2H(3) def: "Trideuteration." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=262] synonym: "Trideuteration" [] xref: record_id "262" xref: delta_mono_mass "3.01883" xref: delta_avge_mass "3.0185" xref: delta_composition "H(-3) 2H(3)" xref: username_of_poster "mmolloy" xref: group_of_poster "users" xref: date_time_posted "2004-09-29 08:52:01" xref: date_time_modified "2013-02-22 12:42:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "for SILAC expt" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "M" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:264 name: PET def: "Phosphorylation to pyridyl thiol." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=264] comment: PET = 2-[4-pyridyl]ethanethiol. This modification is a chemical derivative, based on a alkaline catalysed beta-elimination of phosphoserines and phosphothreonines and subsequent 1,4-addition of 2-[4-pyridine]ethanethiol. These modified serines and threonines produce in MS/MS a characteristic fragment which can be used for precursor-ion-scan experiments. synonym: "b-elimination PET derivatisation" [] xref: record_id "264" xref: delta_mono_mass "121.035005" xref: delta_avge_mass "121.2028" xref: delta_composition "H(7) C(7) N O(-1) S" xref: username_of_poster "vbad" xref: group_of_poster "users" xref: date_time_posted "2004-10-07 08:55:33" xref: date_time_modified "2006-10-16 12:48:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:267 name: Label:13C(6)15N(4) def: "13C(6) 15N(4) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=267] xref: record_id "267" xref: delta_mono_mass "10.008269" xref: delta_avge_mass "9.9296" xref: delta_composition "C(-6) 13C(6) N(-4) 15N(4)" xref: username_of_poster "AFCS" xref: group_of_poster "users" xref: date_time_posted "2004-10-20 17:49:33" xref: date_time_modified "2006-10-19 10:30:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:268 name: Label:13C(5)15N(1) def: "13C(5) 15N(1) Silac label." [PMID:12771378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=268] xref: record_id "268" xref: delta_mono_mass "6.013809" xref: delta_avge_mass "5.9567" xref: delta_composition "C(-5) 13C(5) N(-1) 15N" xref: username_of_poster "Deepa" xref: group_of_poster "users" xref: date_time_posted "2004-11-05 18:49:37" xref: date_time_modified "2011-11-21 14:48:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in AQUA experiment" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "P" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "Result of conversion of 13C6, 15N4 arginine to 13C5, 15N1 proline" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "M" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "SILAC label used in COFRADIC" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "E" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:269 name: Label:13C(9)15N(1) def: "13C(9) 15N(1) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12771378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=269] xref: record_id "269" xref: delta_mono_mass "10.027228" xref: delta_avge_mass "9.9273" xref: delta_composition "C(-9) 13C(9) N(-1) 15N" xref: username_of_poster "Deepa" xref: group_of_poster "users" xref: date_time_posted "2004-11-05 18:51:13" xref: date_time_modified "2006-10-19 10:31:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in AQUA experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:270 name: Cytopiloyne def: "Nucleophilic addtion to cytopiloyne." [PMID:15549660, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=270] comment: Cytopiloyne is a polyacetylenic glucoside isolated form Bidens pilosa which can modulate T helper cell differentiation. Biotinylated cytopiloyne might be use to identify its receptor in T cell. xref: record_id "270" xref: delta_mono_mass "362.136553" xref: delta_avge_mass "362.3738" xref: delta_composition "H(22) C(19) O(7)" xref: username_of_poster "ymchiang" xref: group_of_poster "users" xref: date_time_posted "2004-11-10 03:13:23" xref: date_time_modified "2006-10-16 16:35:54" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "P" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "R" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "S" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "Y" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:271 name: Cytopiloyne+water def: "Nucleophilic addition to cytopiloyne+H2O." [PMID:15549660, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=271] comment: Cytopiloyne is a polyacetylenic glucoside isolated form Bidens pilosa which can modulated T helper cell differentiation. Biotinylated cytopiloyne might be use to identify its receptor in T cell. xref: record_id "271" xref: delta_mono_mass "380.147118" xref: delta_avge_mass "380.3891" xref: delta_composition "H(24) C(19) O(8)" xref: username_of_poster "ymchiang" xref: group_of_poster "users" xref: date_time_posted "2004-11-11 05:23:17" xref: date_time_modified "2006-10-16 16:37:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "Y" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:272 name: CAF def: "Sulfonation of N-terminus." [PMID:15732931, PMID:16046801, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=272] comment: N-terminal sulfonation of diglycine to detect ubiquitination sites. synonym: "Ettan CAF MALDI" [] xref: record_id "272" xref: delta_mono_mass "135.983029" xref: delta_avge_mass "136.1265" xref: delta_composition "H(4) C(3) O(4) S" xref: username_of_poster "chens002" xref: group_of_poster "users" xref: date_time_posted "2004-11-16 14:25:33" xref: date_time_modified "2007-01-03 19:34:35" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:275 name: Nitrosyl def: "Nitrosylation." [FindMod:NTRY, PMID:10442087, RESID:AA0230, PMID:15688001, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=275] xref: record_id "275" xref: delta_mono_mass "28.990164" xref: delta_avge_mass "28.9982" xref: delta_composition "H(-1) N O" xref: username_of_poster "dengh" xref: group_of_poster "users" xref: date_time_posted "2004-12-11 00:23:12" xref: date_time_modified "2019-09-10 09:17:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "S-nitrosylation" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "photochemical decomposition" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:276 name: AEBS def: "Aminoethylbenzenesulfonylation." [PMID:8597590, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=276] comment: Potential protein modification when using AEBSF (Pefabloc) as a serine protease inhibitor. xref: record_id "276" xref: delta_mono_mass "183.035399" xref: delta_avge_mass "183.2276" xref: delta_composition "H(9) C(8) N O(2) S" xref: username_of_poster "plattm" xref: group_of_poster "users" xref: date_time_posted "2004-12-14 04:38:25" xref: date_time_modified "2006-10-16 15:04:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Artefact" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" xref: spec_4_misc_notes "Primary site of modification" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "Y" xref: spec_5_position "Anywhere" xref: spec_5_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:278 name: Ethanolyl def: "Ethanolation." [PMID:15351294, PMID:7730303, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=278] synonym: "Hydroxy ethyl" [] xref: record_id "278" xref: delta_mono_mass "44.026215" xref: delta_avge_mass "44.0526" xref: delta_composition "H(4) C(2) O" xref: username_of_poster "knierman" xref: group_of_poster "users" xref: date_time_posted "2005-01-11 04:26:47" xref: date_time_modified "2017-10-09 15:47:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "from reaction of SH group with iodoethanol" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "reduced form of oxidation product" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_misc_notes "reduced form of oxidation product" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:280 name: Ethyl def: "Ethylation." [PMID:9629898, URL:http\://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=2911956&tool=pmcentrez&rendertype=abstract, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=280] xref: record_id "280" xref: delta_mono_mass "28.0313" xref: delta_avge_mass "28.0532" xref: delta_composition "H(4) C(2)" xref: username_of_poster "Qishanl" xref: group_of_poster "users" xref: date_time_posted "2005-01-27 23:18:07" xref: date_time_modified "2015-08-26 14:42:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Multiple" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Protein N-term" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "C-term" xref: spec_5_position "Any C-term" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "D" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:281 name: CoenzymeA def: "Cysteine modified Coenzyme A." [URL:http\://commons.wikimedia.org/wiki/Image\:Coenzyme_a.png, RESID:AA0306, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=281] xref: record_id "281" xref: delta_mono_mass "765.09956" xref: delta_avge_mass "765.5182" xref: delta_composition "H(34) C(21) N(7) O(16) P(3) S" xref: username_of_poster "tremis" xref: group_of_poster "users" xref: date_time_posted "2005-02-01 17:10:00" xref: date_time_modified "2006-10-16 17:15:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:284 name: Methyl:2H(2) def: "Deuterium Methylation of Lysine." [PMID:15525938, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=284] xref: record_id "284" xref: delta_mono_mass "16.028204" xref: delta_avge_mass "16.0389" xref: delta_composition "2H(2) C" xref: username_of_poster "Glebivanov" xref: group_of_poster "users" xref: date_time_posted "2005-02-13 01:26:38" xref: date_time_modified "2016-06-14 11:53:24" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:285 name: SulfanilicAcid def: "Light Sulfanilic Acid (SA) C12." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=285] synonym: "C-Terminal/Glutamate/Aspartate sulfonation" [] xref: record_id "285" xref: delta_mono_mass "155.004099" xref: delta_avge_mass "155.1744" xref: delta_composition "H(5) C(6) N O(2) S" xref: username_of_poster "apanchaud" xref: group_of_poster "users" xref: date_time_posted "2005-02-17 15:48:07" xref: date_time_modified "2006-10-16 14:05:34" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:286 name: SulfanilicAcid:13C(6) def: "Heavy Sulfanilic Acid (SA) C13." [PMID:9254591, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=286] synonym: "C-Terminal/Glutamate/Aspartate sulfonation" [] xref: record_id "286" xref: delta_mono_mass "161.024228" xref: delta_avge_mass "161.1303" xref: delta_composition "H(5) 13C(6) N O(2) S" xref: username_of_poster "apanchaud" xref: group_of_poster "users" xref: date_time_posted "2005-02-17 15:55:52" xref: date_time_modified "2006-10-16 14:08:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:288 name: Trp->Oxolactone def: "Tryptophan oxidation to oxolactone." [PMID:7949339, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=288] comment: The cleavage of a peptide bond between Try-Xxx with oxidation of tryptophan to the oxolactone occurs in the presence of BNPS-skatole. This is a useful method for the chemical cleavage of proteins specifically at tryptophan residues. xref: record_id "288" xref: delta_mono_mass "13.979265" xref: delta_avge_mass "13.9835" xref: delta_composition "H(-2) O" xref: username_of_poster "oxolactone" xref: group_of_poster "users" xref: date_time_posted "2005-02-25 23:30:20" xref: date_time_modified "2006-10-14 10:06:01" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:289 name: Biotin-PEO-Amine def: "Biotin polyethyleneoxide amine." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=289] comment: EDC crosslinker is used to couple biotin PEO-amine to carboxyl groups or 5\' phosphate groups. xref: record_id "289" xref: delta_mono_mass "356.188212" xref: delta_avge_mass "356.4835" xref: delta_composition "H(28) C(16) N(4) O(3) S" xref: username_of_poster "TBricker1" xref: group_of_poster "users" xref: date_time_posted "2005-03-02 16:49:17" xref: date_time_modified "2006-11-14 11:15:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "EDC-coupled modification of D, E and C-terminus" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "EDC-coupled modification of D, E and C-terminus" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_misc_notes "EDC-coupled modification of D, E and C-terminus" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:290 name: Biotin-HPDP def: "Pierce EZ-Link Biotin-HPDP." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031002, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=290] xref: record_id "290" xref: delta_mono_mass "428.191582" xref: delta_avge_mass "428.6124" xref: delta_composition "H(32) C(19) N(4) O(3) S(2)" xref: username_of_poster "tgreco" xref: group_of_poster "users" xref: date_time_posted "2005-03-03 22:56:52" xref: date_time_modified "2010-12-03 16:28:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:291 name: Delta:Hg(1) def: "Mercury Mercaptan." [PMID:10695144, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=291] xref: record_id "291" xref: delta_mono_mass "201.970617" xref: delta_avge_mass "200.59" xref: delta_composition "Hg" xref: username_of_poster "tgreco" xref: group_of_poster "users" xref: date_time_posted "2005-03-03 23:53:00" xref: date_time_modified "2006-10-16 15:09:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:292 name: IodoU-AMP def: "(Iodo)-uracil MP." [PMID:11567090, PMID:11112526, PMID:6540775, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=292] comment: One note about this chemistry is that for W you have to take care of O2 big time (and extract the I-uracil monophosphate with organics to get rid of residual iodide). synonym: "UV induced linkage of Iodo-U-amp with WFY" [] xref: record_id "292" xref: delta_mono_mass "322.020217" xref: delta_avge_mass "322.1654" xref: delta_composition "H(11) C(9) N(2) O(9) P" xref: username_of_poster "davidERICanderson" xref: group_of_poster "users" xref: date_time_posted "2005-03-04 22:57:55" xref: date_time_modified "2017-01-31 13:36:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Used in base/residue interactions (in principle?)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "Used in base/residue interactions (observed)" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_misc_notes "Used in base/residue interactions (in principle?)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:293 name: CAMthiopropanoyl def: "3-(carbamidomethylthio)propanoyl." [PMID:15121203, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=293] synonym: "3-thiopropanoyl moiety from reduced DSP crosslinker or NHS-SS-biotin, modified with Iodoacetamide" [] xref: record_id "293" xref: delta_mono_mass "145.019749" xref: delta_avge_mass "145.1796" xref: delta_composition "H(7) C(5) N O(2) S" xref: username_of_poster "vanschra" xref: group_of_poster "users" xref: date_time_posted "2005-03-09 15:22:46" xref: date_time_modified "2006-10-16 13:58:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:294 name: IED-Biotin def: "Biotinoyl-iodoacetyl-ethylenediamine." [PMID:10906242, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=294] xref: record_id "294" xref: delta_mono_mass "326.141261" xref: delta_avge_mass "326.4145" xref: delta_composition "H(22) C(14) N(4) O(3) S" xref: username_of_poster "alexey" xref: group_of_poster "users" xref: date_time_posted "2005-03-10 16:28:09" xref: date_time_modified "2006-10-16 15:53:29" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:295 name: dHex def: "Fucose." [PMID:15189151, PMID:11344537, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=295] synonym: "deoxyhexose" [] xref: record_id "295" xref: delta_mono_mass "146.057909" xref: delta_avge_mass "146.1412" xref: delta_composition "dHex" xref: username_of_poster "rsack" xref: group_of_poster "users" xref: date_time_posted "2005-03-22 16:57:00" xref: date_time_modified "2017-11-23 11:42:26" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_147_mono_mass "146.057909" xref: spec_1_neutral_loss_147_avge_mass "146.1412" xref: spec_1_neutral_loss_147_flag "false" xref: spec_1_neutral_loss_147_composition "dHex" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_147_mono_mass "146.057909" xref: spec_1_neutral_loss_147_avge_mass "146.1412" xref: spec_1_neutral_loss_147_flag "false" xref: spec_1_neutral_loss_147_composition "dHex" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_misc_notes "Not reported for human proteins" xref: spec_2_neutral_loss_147_mono_mass "146.057909" xref: spec_2_neutral_loss_147_avge_mass "146.1412" xref: spec_2_neutral_loss_147_flag "false" xref: spec_2_neutral_loss_147_composition "dHex" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:298 name: Methyl:2H(3) def: "Deuterated methyl ester." [URL:http\://www.sigmaaldrich.com/technical-documents/articles/stable-isotopes/stable-isotope-labeling-by-amino-acids.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=298] xref: record_id "298" xref: delta_mono_mass "17.03448" xref: delta_avge_mass "17.0451" xref: delta_composition "H(-1) 2H(3) C" xref: username_of_poster "ndacoyas" xref: group_of_poster "users" xref: date_time_posted "2005-03-24 16:31:28" xref: date_time_modified "2013-02-07 16:43:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "esterification of carboxylic acids using D3-Methanolic HCl" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "esterification of carboxylic acids using D3-Methanolic HCl" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "esterification of carboxylic acids using D3-Methanolic HCl" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "K" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "SILAC labelling with L-Methionine-(methyl-d3)" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "R" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "SILAC labelling with L-Methionine-(methyl-d3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:299 name: Carboxy def: "Carboxylation." [RESID:AA0114, FindMod:GGLU, RESID:AA0363, RESID:AA0032, PMID:3802193, RESID:AA0304, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=299] xref: record_id "299" xref: delta_mono_mass "43.989829" xref: delta_avge_mass "44.0095" xref: delta_composition "C O(2)" xref: username_of_poster "Carol" xref: group_of_poster "users" xref: date_time_posted "2005-03-29 22:55:44" xref: date_time_modified "2006-11-14 11:08:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "D" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_3_misc_notes "Gamma-carboxylation" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "E" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_4_misc_notes "Gamma-carboxylation" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "M" xref: spec_5_position "Protein N-term" xref: spec_5_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:301 name: Bromobimane def: "Monobromobimane derivative." [PMID:7856876, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=301] synonym: "mBromobimane" [] xref: record_id "301" xref: delta_mono_mass "190.074228" xref: delta_avge_mass "190.1986" xref: delta_composition "H(10) C(10) N(2) O(2)" xref: username_of_poster "catsriku" xref: group_of_poster "users" xref: date_time_posted "2005-04-04 23:03:13" xref: date_time_modified "2006-10-16 15:07:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:302 name: Menadione def: "Menadione quinone derivative." [PMID:15939799, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=302] synonym: "Vitamin k3 (Q)" [] xref: record_id "302" xref: delta_mono_mass "170.036779" xref: delta_avge_mass "170.1641" xref: delta_composition "H(6) C(11) O(2)" xref: username_of_poster "catsriku" xref: group_of_poster "users" xref: date_time_posted "2005-04-04 23:21:29" xref: date_time_modified "2007-07-12 07:36:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:303 name: DeStreak def: "Cysteine mercaptoethanol." [PMID:12442261, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=303] xref: record_id "303" xref: delta_mono_mass "75.998285" xref: delta_avge_mass "76.1176" xref: delta_composition "H(4) C(2) O S" xref: username_of_poster "harald" xref: group_of_poster "users" xref: date_time_posted "2005-04-11 14:06:08" xref: date_time_modified "2006-10-16 11:07:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:305 name: dHex(1)Hex(3)HexNAc(4) def: "FA2/G0F." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=305] xref: record_id "305" xref: delta_mono_mass "1444.53387" xref: delta_avge_mass "1445.3331" xref: delta_composition "dHex Hex(3) HexNAc(4)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 18:20:12" xref: date_time_modified "2020-08-02 11:42:31" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1445_mono_mass "1444.53387" xref: spec_1_neutral_loss_1445_avge_mass "1445.3331" xref: spec_1_neutral_loss_1445_flag "false" xref: spec_1_neutral_loss_1445_composition "dHex Hex(3) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1445_mono_mass "1444.53387" xref: spec_2_neutral_loss_1445_avge_mass "1445.3331" xref: spec_2_neutral_loss_1445_flag "false" xref: spec_2_neutral_loss_1445_composition "dHex Hex(3) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1445_mono_mass "1444.53387" xref: spec_2_neutral_loss_1445_avge_mass "1445.3331" xref: spec_2_neutral_loss_1445_flag "false" xref: spec_2_neutral_loss_1445_composition "dHex Hex(3) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:307 name: dHex(1)Hex(4)HexNAc(4) def: "FA2G1/G1F." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=307] synonym: "dHex Hex(4) HexNAc(4) ---OR--- Hex(4) HexNAc(4) Pent Me" [] xref: record_id "307" xref: delta_mono_mass "1606.586693" xref: delta_avge_mass "1607.4737" xref: delta_composition "dHex Hex(4) HexNAc(4)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 19:22:11" xref: date_time_modified "2020-08-02 11:55:46" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1607_mono_mass "1606.586693" xref: spec_1_neutral_loss_1607_avge_mass "1607.4737" xref: spec_1_neutral_loss_1607_flag "false" xref: spec_1_neutral_loss_1607_composition "dHex Hex(4) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1607_mono_mass "1606.586693" xref: spec_2_neutral_loss_1607_avge_mass "1607.4737" xref: spec_2_neutral_loss_1607_flag "false" xref: spec_2_neutral_loss_1607_composition "dHex Hex(4) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1607_mono_mass "1606.586693" xref: spec_2_neutral_loss_1607_avge_mass "1607.4737" xref: spec_2_neutral_loss_1607_flag "false" xref: spec_2_neutral_loss_1607_composition "dHex Hex(4) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:308 name: dHex(1)Hex(5)HexNAc(4) def: "FA2G2/G2F." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=308] xref: record_id "308" xref: delta_mono_mass "1768.639517" xref: delta_avge_mass "1769.6143" xref: delta_composition "dHex Hex(5) HexNAc(4)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 19:25:17" xref: date_time_modified "2020-08-02 11:41:19" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1769_mono_mass "1768.639517" xref: spec_1_neutral_loss_1769_avge_mass "1769.6143" xref: spec_1_neutral_loss_1769_flag "false" xref: spec_1_neutral_loss_1769_composition "dHex Hex(5) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:309 name: Hex(3)HexNAc(4) def: "A2/G0." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=309] xref: record_id "309" xref: delta_mono_mass "1298.475961" xref: delta_avge_mass "1299.1919" xref: delta_composition "Hex(3) HexNAc(4)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 19:27:51" xref: date_time_modified "2020-08-02 11:39:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1299_mono_mass "1298.475961" xref: spec_1_neutral_loss_1299_avge_mass "1299.1919" xref: spec_1_neutral_loss_1299_flag "false" xref: spec_1_neutral_loss_1299_composition "Hex(3) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1299_mono_mass "1298.475961" xref: spec_2_neutral_loss_1299_avge_mass "1299.1919" xref: spec_2_neutral_loss_1299_flag "false" xref: spec_2_neutral_loss_1299_composition "Hex(3) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1299_mono_mass "1298.475961" xref: spec_2_neutral_loss_1299_avge_mass "1299.1919" xref: spec_2_neutral_loss_1299_flag "false" xref: spec_2_neutral_loss_1299_composition "Hex(3) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:310 name: Hex(4)HexNAc(4) def: "A2G1/G1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=310] xref: record_id "310" xref: delta_mono_mass "1460.528784" xref: delta_avge_mass "1461.3325" xref: delta_composition "Hex(4) HexNAc(4)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 19:33:37" xref: date_time_modified "2020-08-02 11:38:53" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1461_mono_mass "1460.528784" xref: spec_1_neutral_loss_1461_avge_mass "1461.3325" xref: spec_1_neutral_loss_1461_flag "false" xref: spec_1_neutral_loss_1461_composition "Hex(4) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1461_mono_mass "1460.528784" xref: spec_2_neutral_loss_1461_avge_mass "1461.3325" xref: spec_2_neutral_loss_1461_flag "false" xref: spec_2_neutral_loss_1461_composition "Hex(4) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1461_mono_mass "1460.528784" xref: spec_2_neutral_loss_1461_avge_mass "1461.3325" xref: spec_2_neutral_loss_1461_flag "false" xref: spec_2_neutral_loss_1461_composition "Hex(4) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:311 name: Hex(5)HexNAc(4) def: "A2G2/G2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=311] xref: record_id "311" xref: delta_mono_mass "1622.581608" xref: delta_avge_mass "1623.4731" xref: delta_composition "Hex(5) HexNAc(4)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 19:35:54" xref: date_time_modified "2020-08-02 11:38:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1623_mono_mass "1622.581608" xref: spec_1_neutral_loss_1623_avge_mass "1623.4731" xref: spec_1_neutral_loss_1623_flag "false" xref: spec_1_neutral_loss_1623_composition "Hex(5) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_misc_notes "Not reported for human proteins" xref: spec_2_neutral_loss_1623_mono_mass "1622.581608" xref: spec_2_neutral_loss_1623_avge_mass "1623.4731" xref: spec_2_neutral_loss_1623_flag "false" xref: spec_2_neutral_loss_1623_composition "Hex(5) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_misc_notes "Not reported for human proteins" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1623_mono_mass "1622.581608" xref: spec_2_neutral_loss_1623_avge_mass "1623.4731" xref: spec_2_neutral_loss_1623_flag "false" xref: spec_2_neutral_loss_1623_composition "Hex(5) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:312 name: Cysteinyl def: "Cysteinylation." [RESID:AA0025, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=312] xref: record_id "312" xref: delta_mono_mass "119.004099" xref: delta_avge_mass "119.1423" xref: delta_composition "H(5) C(3) N O(2) S" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 19:59:43" xref: date_time_modified "2006-12-17 11:28:36" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:313 name: Lys-loss def: "Loss of C-terminal K from Heavy Chain of MAb." [PMID:16078144, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=313] xref: record_id "313" xref: delta_mono_mass "-128.094963" xref: delta_avge_mass "-128.1723" xref: delta_composition "H(-12) C(-6) N(-2) O(-1)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 20:05:38" xref: date_time_modified "2006-10-13 15:00:47" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:314 name: Nmethylmaleimide def: "Nmethylmaleimide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=314] xref: record_id "314" xref: delta_mono_mass "111.032028" xref: delta_avge_mass "111.0987" xref: delta_composition "H(5) C(5) N O(2)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-04-25 20:12:24" xref: date_time_modified "2006-10-16 17:26:09" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:316 name: DimethylpyrroleAdduct def: "2,5-dimethypyrrole." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=316] xref: record_id "316" xref: delta_mono_mass "78.04695" xref: delta_avge_mass "78.1118" xref: delta_composition "H(6) C(6)" xref: username_of_poster "Qishanl" xref: group_of_poster "users" xref: date_time_posted "2005-05-07 03:11:23" xref: date_time_modified "2006-10-16 11:14:22" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:318 name: Delta:H(2)C(5) def: "MDA adduct +62." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=318] comment: Usually major adduct formed from malondialdehyde (MDA) with the amino group of lysine residues. synonym: "MDA62" [] xref: record_id "318" xref: delta_mono_mass "62.01565" xref: delta_avge_mass "62.0694" xref: delta_composition "H(2) C(5)" xref: username_of_poster "rkupfer" xref: group_of_poster "users" xref: date_time_posted "2005-05-12 22:00:21" xref: date_time_modified "2006-10-16 10:29:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:319 name: Delta:H(2)C(3)O(1) def: "MDA adduct +54." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=319] synonym: "MDA54" [] xref: record_id "319" xref: delta_mono_mass "54.010565" xref: delta_avge_mass "54.0474" xref: delta_composition "H(2) C(3) O" xref: username_of_poster "rkupfer" xref: group_of_poster "users" xref: date_time_posted "2005-05-12 22:12:10" xref: date_time_modified "2006-10-16 10:15:34" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Malondialdehyde (MDA) adduct" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "5-hydro-5-methylimidazol-4-one, Methylglyoxal adduct" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:320 name: Nethylmaleimide+water def: "Nethylmaleimidehydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=320] xref: record_id "320" xref: delta_mono_mass "143.058243" xref: delta_avge_mass "143.1406" xref: delta_composition "H(9) C(6) N O(3)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2005-05-16 22:18:42" xref: date_time_modified "2006-10-17 11:40:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:323 name: Xlink:B10621 def: "Bis-((N-iodoacetyl)piperazinyl)sulfonerhodamine." [URL:https\://www.thermofisher.com/us/en/home/references/molecular-probes-the-handbook/crosslinking-and-photoactivatable-reagents/chemical-crosslinking-reagents.html#head2, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=323] comment: Discontinued Invitrogen X-link reagent. synonym: "BSR monolink" [] xref: record_id "323" xref: delta_mono_mass "713.093079" xref: delta_avge_mass "713.5626" xref: delta_composition "H(30) C(31) N(4) O(6) S I" xref: username_of_poster "dengh" xref: group_of_poster "users" xref: date_time_posted "2005-05-17 22:56:12" xref: date_time_modified "2017-09-05 15:32:46" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:324 name: Xlink:DTBP[87] def: "Cleaved and reduced DTBP crosslinker." [PMID:770170, URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011314_ImidoesterCrsLnk_DMA_DMP_DMS_DTBP_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=324] comment: Imidoester cross-linker. synonym: "dimethyl 3,3'-dithiobispropionimidate" [] xref: record_id "324" xref: delta_mono_mass "87.01427" xref: delta_avge_mass "87.1435" xref: delta_composition "H(5) C(3) N S" xref: username_of_poster "takesin" xref: group_of_poster "users" xref: date_time_posted "2005-05-18 08:43:26" xref: date_time_modified "2017-08-18 14:19:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:325 name: FP-Biotin def: "10-ethoxyphosphinyl-N-(biotinamidopentyl)decanamide." [PMID:10611275, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=325] comment: FP-biotin was designed to label the active site serine of serine esterases/proteases. synonym: "O-ethyl-N-(biotinamidopentyl)decanamido phosphonate" [] xref: record_id "325" xref: delta_mono_mass "572.316129" xref: delta_avge_mass "572.7405" xref: delta_composition "H(49) C(27) N(4) O(5) P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "users" xref: date_time_posted "2005-05-19 22:01:37" xref: date_time_modified "2010-02-24 20:54:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "K" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:327 name: Delta:H(4)C(2)O(-1)S(1) def: "S-Ethylcystine from Serine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=327] comment: Phosphoserine to S-ethylcystine via Beta elimination/Michael addition of ethylthiol. xref: record_id "327" xref: delta_mono_mass "44.008456" xref: delta_avge_mass "44.1188" xref: delta_composition "H(4) C(2) O(-1) S" xref: username_of_poster "UCDMSF" xref: group_of_poster "users" xref: date_time_posted "2005-06-20 20:09:02" xref: date_time_modified "2006-10-16 10:00:57" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:329 name: Methyl:2H(3)13C(1) def: "Monomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=329] xref: record_id "329" xref: delta_mono_mass "18.037835" xref: delta_avge_mass "18.0377" xref: delta_composition "H(-1) 2H(3) 13C" xref: username_of_poster "sams" xref: group_of_poster "users" xref: date_time_posted "2005-06-30 18:19:34" xref: date_time_modified "2016-06-14 11:54:23" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:330 name: Dimethyl:2H(6)13C(2) def: "Dimethylation." [PMID:15782174, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=330] xref: record_id "330" xref: delta_mono_mass "36.07567" xref: delta_avge_mass "36.0754" xref: delta_composition "H(-2) 2H(6) 13C(2)" xref: username_of_poster "sams" xref: group_of_poster "users" xref: date_time_posted "2005-06-30 18:21:32" xref: date_time_modified "2014-11-16 07:36:47" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Protein N-term" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "When dimethyl labelling is pre-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:332 name: Thiophos-S-S-biotin def: "Thiophosphate labeled with biotin-HPDP." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=332] synonym: "Thiophos-biotin disulfide" [] xref: record_id "332" xref: delta_mono_mass "525.142894" xref: delta_avge_mass "525.6658" xref: delta_composition "H(34) C(19) N(4) O(5) P S(3)" xref: username_of_poster "lparker" xref: group_of_poster "users" xref: date_time_posted "2005-07-21 16:37:10" xref: date_time_modified "2006-10-16 17:02:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_neutral_loss_526_mono_mass "525.142894" xref: spec_1_neutral_loss_526_avge_mass "525.6658" xref: spec_1_neutral_loss_526_flag "false" xref: spec_1_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_neutral_loss_526_mono_mass "525.142894" xref: spec_2_neutral_loss_526_avge_mass "525.6658" xref: spec_2_neutral_loss_526_flag "false" xref: spec_2_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_neutral_loss_526_mono_mass "525.142894" xref: spec_3_neutral_loss_526_avge_mass "525.6658" xref: spec_3_neutral_loss_526_flag "false" xref: spec_3_neutral_loss_526_composition "H(34) C(19) N(4) O(5) P S(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:333 name: Can-FP-biotin def: "6-N-biotinylaminohexyl isopropyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=333] comment: Commercially available from Toronto Research Chemicals Inc, as of 2005. Designed to label the active site serine of serine esterases/proteases. synonym: "O-isopropyl-N-biotinylaminohexyl phosphonate" [] xref: record_id "333" xref: delta_mono_mass "447.195679" xref: delta_avge_mass "447.5291" xref: delta_composition "H(34) C(19) N(3) O(5) P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "users" xref: date_time_posted "2005-07-21 20:54:00" xref: date_time_modified "2010-12-03 16:24:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:335 name: HNE+Delta:H(2) def: "Reduced 4-Hydroxynonenal." [PMID:11910026, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=335] comment: Michael addition adduct of 4-hydroxynonenal with histidine, cystein and lysine residues stabilized by reduction with NaBH4. xref: record_id "335" xref: delta_mono_mass "158.13068" xref: delta_avge_mass "158.238" xref: delta_composition "H(18) C(9) O(2)" xref: username_of_poster "rkupfer" xref: group_of_poster "users" xref: date_time_posted "2005-08-10 20:52:36" xref: date_time_modified "2011-07-18 11:28:34" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:337 name: Methylamine def: "Michael addition with methylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=337] xref: record_id "337" xref: delta_mono_mass "13.031634" xref: delta_avge_mass "13.0418" xref: delta_composition "H(3) C N O(-1)" xref: username_of_poster "zhulx" xref: group_of_poster "users" xref: date_time_posted "2005-08-12 21:55:51" xref: date_time_modified "2006-10-14 10:02:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:340 name: Bromo def: "Bromination." [PMID:9033387, RESID:AA0174, RESID:AA0175, RESID:AA0176, RESID:AA0173, RESID:AA0180, RESID:AA0179, FindMod:BROM, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=340] xref: record_id "340" xref: delta_mono_mass "77.910511" xref: delta_avge_mass "78.8961" xref: delta_composition "H(-1) Br" xref: username_of_poster "gerribe" xref: group_of_poster "users" xref: date_time_posted "2005-09-06 08:31:51" xref: date_time_modified "2011-11-21 12:07:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "F" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:342 name: Amino def: "Tyrosine oxidation to 2-aminotyrosine." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=342] xref: record_id "342" xref: delta_mono_mass "15.010899" xref: delta_avge_mass "15.0146" xref: delta_composition "H N" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 21:18:23" xref: date_time_modified "2006-10-14 10:39:53" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:343 name: Argbiotinhydrazide def: "Oxidized Arginine biotinylated with biotin hydrazide." [PMID:15828771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=343] xref: record_id "343" xref: delta_mono_mass "199.066699" xref: delta_avge_mass "199.27" xref: delta_composition "H(13) C(9) N O(2) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:36:58" xref: date_time_modified "2006-11-14 12:10:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:344 name: Arg->GluSA def: "Arginine oxidation to glutamic semialdehyde." [PMID:9252331, PMID:1680314, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=344] synonym: "Arginine oxidation to gamma-glutamyl semialdehyde" [] xref: record_id "344" xref: delta_mono_mass "-43.053433" xref: delta_avge_mass "-43.0711" xref: delta_composition "H(-5) C(-1) N(-3) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:38:24" xref: date_time_modified "2006-11-16 15:25:28" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:345 name: Trioxidation def: "Cysteine oxidation to cysteic acid." [PMID:14678012, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=345] xref: record_id "345" xref: delta_mono_mass "47.984744" xref: delta_avge_mass "47.9982" xref: delta_composition "O(3)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:39:38" xref: date_time_modified "2017-11-08 16:28:19" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "F" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:348 name: His->Asn def: "His->Asn substitution." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=348] synonym: "histidine oxidation to aspargine" [] xref: record_id "348" xref: delta_mono_mass "-23.015984" xref: delta_avge_mass "-23.0366" xref: delta_composition "H(-1) C(-2) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:43:27" xref: date_time_modified "2011-06-23 12:00:22" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_1_misc_notes "Could also be classed as chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:349 name: His->Asp def: "His->Asp substitution." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=349] synonym: "histidine oxidation to aspartic acid" [] xref: record_id "349" xref: delta_mono_mass "-22.031969" xref: delta_avge_mass "-22.0519" xref: delta_composition "H(-2) C(-2) N(-2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:44:32" xref: date_time_modified "2011-06-23 12:00:45" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_1_misc_notes "Could also be classed as chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:350 name: Trp->Hydroxykynurenin def: "Tryptophan oxidation to hydroxykynurenin." [URL:http\://www.lbqp.unb.br/bioq/htm/aulas2D/deg_aa_ile_leu_trp.htm?reload_coolmenus, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=350] xref: record_id "350" xref: delta_mono_mass "19.989829" xref: delta_avge_mass "19.9881" xref: delta_composition "C(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:47:20" xref: date_time_modified "2006-11-14 17:40:45" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:351 name: Trp->Kynurenin def: "Tryptophan oxidation to kynurenin." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=351] xref: record_id "351" xref: delta_mono_mass "3.994915" xref: delta_avge_mass "3.9887" xref: delta_composition "C(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:48:33" xref: date_time_modified "2006-10-14 09:39:53" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:352 name: Lys->Allysine def: "Lysine oxidation to aminoadipic semialdehyde." [RESID:AA0121, FindMod:ALLYS, PMID:9252331, PMID:11120890, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=352] xref: record_id "352" xref: delta_mono_mass "-1.031634" xref: delta_avge_mass "-1.0311" xref: delta_composition "H(-3) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:49:59" xref: date_time_modified "2006-10-13 18:27:28" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:353 name: Lysbiotinhydrazide def: "Oxidized Lysine biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=353] xref: record_id "353" xref: delta_mono_mass "241.088497" xref: delta_avge_mass "241.31" xref: delta_composition "H(15) C(10) N(3) O(2) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:51:13" xref: date_time_modified "2006-11-14 12:12:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:354 name: Nitro def: "Oxidation to nitro." [PMID:8839040, PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=354] xref: record_id "354" xref: delta_mono_mass "44.985078" xref: delta_avge_mass "44.9976" xref: delta_composition "H(-1) N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:52:38" xref: date_time_modified "2017-11-08 16:26:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "F" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:357 name: probiotinhydrazide def: "Oxidized proline biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, PMID:15174056, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=357] xref: record_id "357" xref: delta_mono_mass "258.115047" xref: delta_avge_mass "258.3405" xref: delta_composition "H(18) C(10) N(4) O(2) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:56:20" xref: date_time_modified "2006-11-14 12:12:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:359 name: Pro->pyro-Glu def: "Proline oxidation to pyroglutamic acid." [PMID:9252331, PMID:10717661, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=359] xref: record_id "359" xref: delta_mono_mass "13.979265" xref: delta_avge_mass "13.9835" xref: delta_composition "H(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 22:58:42" xref: date_time_modified "2006-10-14 10:03:34" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:360 name: Pro->Pyrrolidinone def: "Proline oxidation to pyrrolidinone." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=360] xref: record_id "360" xref: delta_mono_mass "-30.010565" xref: delta_avge_mass "-30.026" xref: delta_composition "H(-2) C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 23:00:19" xref: date_time_modified "2006-10-13 15:37:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:361 name: Thrbiotinhydrazide def: "Oxidized Threonine biotinylated with biotin hydrazide." [URL:http\://www.piercenet.com/Proteomics/browse.cfm?fldID=84EBE112-F871-4CA5-807F-47327153CFCB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=361] xref: record_id "361" xref: delta_mono_mass "240.104482" xref: delta_avge_mass "240.3252" xref: delta_composition "H(16) C(10) N(4) O S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-09-10 23:01:28" xref: date_time_modified "2006-11-14 12:12:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:362 name: Diisopropylphosphate def: "O-Diisopropylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=362] comment: A selective label for the active site serine of the serine esterase/protease family. It has also been shown to label tyrosine in serum albumin. xref: record_id "362" xref: delta_mono_mass "164.060231" xref: delta_avge_mass "164.1394" xref: delta_composition "H(13) C(6) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "users" xref: date_time_posted "2005-09-14 18:05:04" xref: date_time_modified "2011-12-05 16:14:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "K" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Any N-term" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:363 name: Isopropylphospho def: "O-Isopropylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=363] comment: Created by auto-catalytic dealkylation of the O-Diisopropylphosphate adduct. xref: record_id "363" xref: delta_mono_mass "122.013281" xref: delta_avge_mass "122.0596" xref: delta_composition "H(7) C(3) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "users" xref: date_time_posted "2005-09-14 18:08:20" xref: date_time_modified "2007-01-15 15:25:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:364 name: ICPL:13C(6) def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, heavy form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=364] comment: Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied. xref: record_id "364" xref: delta_mono_mass "111.041593" xref: delta_avge_mass "111.05" xref: delta_composition "H(3) 13C(6) N O" xref: username_of_poster "suckau" xref: group_of_poster "users" xref: date_time_posted "2005-09-19 12:45:52" xref: date_time_modified "2008-09-03 15:27:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "Use when labelling pre-digest" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Use when labelling post-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:365 name: ICPL def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, light form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=365] comment: Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied. xref: record_id "365" xref: delta_mono_mass "105.021464" xref: delta_avge_mass "105.0941" xref: delta_composition "H(3) C(6) N O" xref: username_of_poster "suckau" xref: group_of_poster "users" xref: date_time_posted "2005-09-19 13:00:14" xref: date_time_modified "2008-09-03 15:26:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "Use when labelling pre-digest" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Use when labelling post-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:366 name: Deamidated:18O(1) def: "Deamidation in presence of O18." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=366] comment: Observed. xref: record_id "366" xref: delta_mono_mass "2.988261" xref: delta_avge_mass "2.9845" xref: delta_composition "H(-1) N(-1) 18O" xref: username_of_poster "gerribe" xref: group_of_poster "users" xref: date_time_posted "2005-09-22 15:30:16" xref: date_time_modified "2006-10-14 09:35:33" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:368 name: Cys->Dha def: "Dehydroalanine (from Cysteine)." [PMID:11212008, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=368] xref: record_id "368" xref: delta_mono_mass "-33.987721" xref: delta_avge_mass "-34.0809" xref: delta_composition "H(-2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-02 17:31:11" xref: date_time_modified "2006-10-13 15:27:46" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:369 name: Pro->Pyrrolidone def: "Pyrrolidone from Proline." [PMID:9252331, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=369] xref: record_id "369" xref: delta_mono_mass "-27.994915" xref: delta_avge_mass "-28.0101" xref: delta_composition "C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-02 17:39:05" xref: date_time_modified "2006-11-14 11:12:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:371 name: HMVK def: "Michael addition of hydroxymethylvinyl ketone to cysteine." [PMID:11743741, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=371] synonym: "hydroxymethylvinyl ketone" [] xref: record_id "371" xref: delta_mono_mass "86.036779" xref: delta_avge_mass "86.0892" xref: delta_composition "H(6) C(4) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-03 15:59:33" xref: date_time_modified "2006-10-16 12:15:35" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:372 name: Arg->Orn def: "Ornithine from Arginine." [PMID:15489230, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=372] xref: record_id "372" xref: delta_mono_mass "-42.021798" xref: delta_avge_mass "-42.04" xref: delta_composition "H(-2) C(-1) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-05 17:55:25" xref: date_time_modified "2006-10-13 15:26:33" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:374 name: Dehydro def: "Half of a disulfide bridge." [RESID:AA0025, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=374] xref: record_id "374" xref: delta_mono_mass "-1.007825" xref: delta_avge_mass "-1.0079" xref: delta_composition "H(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-06 20:57:01" xref: date_time_modified "2006-10-13 18:28:17" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:375 name: Diphthamide def: "Diphthamide." [RESID:AA0040, FindMod:DIPH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=375] xref: record_id "375" xref: delta_mono_mass "142.110613" xref: delta_avge_mass "142.1989" xref: delta_composition "H(14) C(7) N(2) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-06 23:21:29" xref: date_time_modified "2015-09-08 17:15:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:376 name: Hydroxyfarnesyl def: "Hydroxyfarnesyl." [RESID:AA0103, FindMod:FAR0, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=376] xref: record_id "376" xref: delta_mono_mass "220.182715" xref: delta_avge_mass "220.3505" xref: delta_composition "H(24) C(15) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-07 20:36:20" xref: date_time_modified "2006-10-16 15:20:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:377 name: Diacylglycerol def: "Diacylglycerol." [RESID:AA0107, FindMod:DIAC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=377] xref: record_id "377" xref: delta_mono_mass "576.511761" xref: delta_avge_mass "576.9334" xref: delta_composition "H(68) C(37) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-07 20:41:21" xref: date_time_modified "2006-10-16 17:05:40" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:378 name: Carboxyethyl def: "Carboxyethyl." [RESID:AA0115, FindMod:CETH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=378] synonym: "Ethoxyformylation" [] xref: record_id "378" xref: delta_mono_mass "72.021129" xref: delta_avge_mass "72.0627" xref: delta_composition "H(4) C(3) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-07 22:18:20" xref: date_time_modified "2021-02-09 10:33:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "Labeling with diethylpyrocarbonate (DEPC)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:379 name: Hypusine def: "Hypusine." [RESID:AA0116, FindMod:HYPU, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=379] xref: record_id "379" xref: delta_mono_mass "87.068414" xref: delta_avge_mass "87.1204" xref: delta_composition "H(9) C(4) N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-07 22:20:53" xref: date_time_modified "2006-10-16 12:35:24" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:380 name: Retinylidene def: "Retinal." [RESID:AA0120, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=380] xref: record_id "380" xref: delta_mono_mass "266.203451" xref: delta_avge_mass "266.4204" xref: delta_composition "H(26) C(20)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-07 22:27:27" xref: date_time_modified "2006-10-16 15:47:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:381 name: Lys->AminoadipicAcid def: "Alpha-amino adipic acid." [RESID:AA0122, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=381] xref: record_id "381" xref: delta_mono_mass "14.96328" xref: delta_avge_mass "14.9683" xref: delta_composition "H(-3) N(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 17:41:37" xref: date_time_modified "2006-10-14 10:33:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:382 name: Cys->PyruvicAcid def: "Pyruvic acid from N-term cys." [RESID:AA0127, FindMod:PYRUC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=382] xref: record_id "382" xref: delta_mono_mass "-33.003705" xref: delta_avge_mass "-33.0961" xref: delta_composition "H(-3) N(-1) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 17:48:42" xref: date_time_modified "2006-10-13 16:42:55" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:385 name: Ammonia-loss def: "Loss of ammonia." [RESID:AA0127, FindMod:PYRUS, RESID:AA0129, FindMod:OXOB, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=385] synonym: "oxobutanoic acid from N term Thr pyruvic acid from N-term ser" [] xref: record_id "385" xref: delta_mono_mass "-17.026549" xref: delta_avge_mass "-17.0305" xref: delta_composition "H(-3) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:00:01" xref: date_time_modified "2007-07-15 20:11:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "C" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" xref: spec_3_misc_notes "Pyro-carbamidomethyl as a delta from Carbamidomethyl-Cys" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_4_misc_notes "N-Succinimide" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:387 name: Phycocyanobilin def: "Phycocyanobilin." [RESID:AA0258, RESID:AA0131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=387] comment: Phycocyanobilin and phycobiliviolin have different structures but the same empirical formula. synonym: "phycobiliviolin" [] xref: record_id "387" xref: delta_mono_mass "586.279135" xref: delta_avge_mass "586.678" xref: delta_composition "H(38) C(33) N(4) O(6)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:06:19" xref: date_time_modified "2006-10-16 17:07:44" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:388 name: Phycoerythrobilin def: "Phycoerythrobilin." [RESID:AA0132, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=388] xref: record_id "388" xref: delta_mono_mass "588.294785" xref: delta_avge_mass "588.6939" xref: delta_composition "H(40) C(33) N(4) O(6)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:08:38" xref: date_time_modified "2006-10-16 17:08:02" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:389 name: Phytochromobilin def: "Phytochromobilin." [RESID:AA0133, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=389] xref: record_id "389" xref: delta_mono_mass "584.263485" xref: delta_avge_mass "584.6621" xref: delta_composition "H(36) C(33) N(4) O(6)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:23:58" xref: date_time_modified "2006-10-16 17:07:22" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:390 name: Heme def: "Heme." [RESID:AA0329, RESID:AA0135, RESID:AA0276, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=390] xref: record_id "390" xref: delta_mono_mass "616.177295" xref: delta_avge_mass "616.4873" xref: delta_composition "H(32) C(34) N(4) O(4) Fe" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:27:20" xref: date_time_modified "2006-10-16 17:10:28" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:391 name: Molybdopterin def: "Molybdopterin." [RESID:AA0142, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=391] xref: record_id "391" xref: delta_mono_mass "521.884073" xref: delta_avge_mass "520.2668" xref: delta_composition "H(11) C(10) N(5) O(8) P S(2) Mo" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:46:19" xref: date_time_modified "2006-10-16 17:02:25" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:392 name: Quinone def: "Quinone." [RESID:AA0147, RESID:AA0148, FindMod:TOPA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=392] xref: record_id "392" xref: delta_mono_mass "29.974179" xref: delta_avge_mass "29.9829" xref: delta_composition "H(-2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 18:56:28" xref: date_time_modified "2006-10-15 18:03:47" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:393 name: Glucosylgalactosyl def: "Glucosylgalactosyl hydroxylysine." [RESID:AA0153, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=393] xref: record_id "393" xref: delta_mono_mass "340.100562" xref: delta_avge_mass "340.2806" xref: delta_composition "O Hex(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 19:19:13" xref: date_time_modified "2015-05-01 14:08:37" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_1_neutral_loss_341_mono_mass "340.100562" xref: spec_1_neutral_loss_341_avge_mass "340.2806" xref: spec_1_neutral_loss_341_flag "false" xref: spec_1_neutral_loss_341_composition "O Hex(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:394 name: GPIanchor def: "Glycosylphosphatidylinositol." [RESID:AA0158, RESID:AA0159, RESID:AA0160, RESID:AA0161, RESID:AA0162, RESID:AA0163, RESID:AA0164, RESID:AA0165, RESID:AA0166, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=394] xref: record_id "394" xref: delta_mono_mass "123.00853" xref: delta_avge_mass "123.0477" xref: delta_composition "H(6) C(2) N O(3) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 19:31:10" xref: date_time_modified "2006-11-14 11:13:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:395 name: PhosphoribosyldephosphoCoA def: "Phosphoribosyl dephospho-coenzyme A." [RESID:AA0167, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=395] xref: record_id "395" xref: delta_mono_mass "881.146904" xref: delta_avge_mass "881.6335" xref: delta_composition "H(42) C(26) N(7) O(19) P(3) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 19:42:56" xref: date_time_modified "2006-10-16 17:19:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:396 name: GlycerylPE def: "Glycerylphosphorylethanolamine." [RESID:AA0170, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=396] xref: record_id "396" xref: delta_mono_mass "197.04531" xref: delta_avge_mass "197.1262" xref: delta_composition "H(12) C(5) N O(5) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 19:50:17" xref: date_time_modified "2006-10-16 15:08:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:397 name: Triiodothyronine def: "Triiodo." [RESID:AA0177, FindMod:THRN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=397] xref: record_id "397" xref: delta_mono_mass "469.716159" xref: delta_avge_mass "469.785" xref: delta_composition "H C(6) O I(3)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 20:08:28" xref: date_time_modified "2006-10-16 16:59:19" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:398 name: Thyroxine def: "Tetraiodo." [RESID:AA0178, FindMod:THRX, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=398] xref: record_id "398" xref: delta_mono_mass "595.612807" xref: delta_avge_mass "595.6815" xref: delta_composition "C(6) O I(4)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 20:10:14" xref: date_time_modified "2006-10-16 17:08:51" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:400 name: Tyr->Dha def: "Dehydroalanine (from Tyrosine)." [RESID:AA0181, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=400] xref: record_id "400" xref: delta_mono_mass "-94.041865" xref: delta_avge_mass "-94.1112" xref: delta_composition "H(-6) C(-6) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 20:17:48" xref: date_time_modified "2006-10-13 15:02:50" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:401 name: Didehydro def: "2-amino-3-oxo-butanoic_acid." [RESID:AA0183, RESID:AA0185, PMID:9252331, RESID:AA0365, FindMod:OXOAS, FindMod:DHY, PMID:15705169, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=401] synonym: "oxoalanine" [] xref: record_id "401" xref: delta_mono_mass "-2.01565" xref: delta_avge_mass "-2.0159" xref: delta_composition "H(-2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 20:23:58" xref: date_time_modified "2008-07-30 12:01:47" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_2_misc_notes "oxoalanine formylglycine" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "K" xref: spec_4_position "Any C-term" xref: spec_4_classification "Artefact" xref: spec_4_misc_notes "Lactone formation from C-terminal hydroxylysine" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:402 name: Cys->Oxoalanine def: "Oxoalanine." [RESID:AA0185, FindMod:OXOAC, PMID:18722427, PMID:17450134, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=402] synonym: "formylglycine" [] xref: record_id "402" xref: delta_mono_mass "-17.992806" xref: delta_avge_mass "-18.0815" xref: delta_composition "H(-2) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 20:29:10" xref: date_time_modified "2009-03-13 16:04:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:403 name: Ser->LacticAcid def: "Lactic acid from N-term Ser." [RESID:AA0186, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=403] xref: record_id "403" xref: delta_mono_mass "-15.010899" xref: delta_avge_mass "-15.0146" xref: delta_composition "H(-1) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 20:34:16" xref: date_time_modified "2006-10-13 17:18:52" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:405 name: Phosphoadenosine def: "AMP." [RESID:AA0371, RESID:AA0227, RESID:AA0203, RESID:AA0267, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=405] xref: record_id "405" xref: delta_mono_mass "329.05252" xref: delta_avge_mass "329.2059" xref: delta_composition "H(12) C(10) N(5) O(6) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 21:34:01" xref: date_time_modified "2021-03-11 13:32:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_136_mono_mass "135.054495" xref: spec_1_neutral_loss_136_avge_mass "135.1267" xref: spec_1_neutral_loss_136_flag "false" xref: spec_1_neutral_loss_136_composition "H(5) C(5) N(5)" xref: spec_1_neutral_loss_250_mono_mass "249.086189" xref: spec_1_neutral_loss_250_avge_mass "249.226" xref: spec_1_neutral_loss_250_flag "false" xref: spec_1_neutral_loss_250_composition "H(11) C(10) N(5) O(3)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_348_mono_mass "347.063085" xref: spec_3_neutral_loss_348_avge_mass "347.2212" xref: spec_3_neutral_loss_348_flag "false" xref: spec_3_neutral_loss_348_composition "H(14) C(10) N(5) O(7) P" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Post-translational" xref: spec_5_neutral_loss_348_mono_mass "347.063085" xref: spec_5_neutral_loss_348_avge_mass "347.2212" xref: spec_5_neutral_loss_348_flag "false" xref: spec_5_neutral_loss_348_composition "H(14) C(10) N(5) O(7) P" xref: spec_5_neutral_loss_0_mono_mass "0" xref: spec_5_neutral_loss_0_avge_mass "0" xref: spec_5_neutral_loss_0_flag "false" xref: spec_5_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:407 name: Hydroxycinnamyl def: "Hydroxycinnamyl." [RESID:AA0207, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=407] xref: record_id "407" xref: delta_mono_mass "146.036779" xref: delta_avge_mass "146.1427" xref: delta_composition "H(6) C(9) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 21:40:43" xref: date_time_modified "2006-10-16 14:02:07" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:408 name: Glycosyl def: "Glycosyl-L-hydroxyproline." [RESID:AA0212, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=408] xref: record_id "408" xref: delta_mono_mass "148.037173" xref: delta_avge_mass "148.114" xref: delta_composition "H(-2) C(-1) Hex" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 21:57:16" xref: date_time_modified "2015-05-01 13:14:26" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:409 name: FMNH def: "Flavin mononucleotide." [RESID:AA0353, RESID:AA0220, RESID:AA0352, FindMod:FMNH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=409] xref: record_id "409" xref: delta_mono_mass "454.088965" xref: delta_avge_mass "454.3279" xref: delta_composition "H(19) C(17) N(4) O(9) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 22:09:45" xref: date_time_modified "2006-10-16 16:57:46" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:410 name: Archaeol def: "S-diphytanylglycerol diether." [RESID:AA0223, FindMod:ARCH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=410] xref: record_id "410" xref: delta_mono_mass "634.662782" xref: delta_avge_mass "635.1417" xref: delta_composition "H(86) C(43) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-11 22:15:37" xref: date_time_modified "2006-10-16 17:10:59" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:411 name: Phenylisocyanate def: "Phenyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=411] xref: record_id "411" xref: delta_mono_mass "119.037114" xref: delta_avge_mass "119.1207" xref: delta_composition "H(5) C(7) N O" xref: username_of_poster "TING" xref: group_of_poster "users" xref: date_time_posted "2005-10-14 21:13:16" xref: date_time_modified "2006-10-16 12:48:08" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:412 name: Phenylisocyanate:2H(5) def: "D5-phenyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=412] xref: record_id "412" xref: delta_mono_mass "124.068498" xref: delta_avge_mass "124.1515" xref: delta_composition "2H(5) C(7) N O" xref: username_of_poster "TING" xref: group_of_poster "users" xref: date_time_posted "2005-10-14 21:16:11" xref: date_time_modified "2006-10-16 13:35:26" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:413 name: Phosphoguanosine def: "Phospho-guanosine." [RESID:AA0325, RESID:AA0228, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=413] xref: record_id "413" xref: delta_mono_mass "345.047435" xref: delta_avge_mass "345.2053" xref: delta_composition "H(12) C(10) N(5) O(7) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 15:50:03" xref: date_time_modified "2006-10-16 16:01:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:414 name: Hydroxymethyl def: "Hydroxymethyl." [RESID:AA0236, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=414] xref: record_id "414" xref: delta_mono_mass "30.010565" xref: delta_avge_mass "30.026" xref: delta_composition "H(2) C O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 16:12:56" xref: date_time_modified "2006-10-15 18:04:18" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:415 name: MolybdopterinGD+Delta:S(-1)Se(1) def: "L-selenocysteinyl molybdenum bis(molybdopterin guanine dinucleotide)." [RESID:AA0248, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=415] xref: record_id "415" xref: delta_mono_mass "1620.930224" xref: delta_avge_mass "1618.9096" xref: delta_composition "H(47) C(40) N(20) O(26) P(4) S(3) Se Mo" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 16:27:56" xref: date_time_modified "2006-10-17 11:44:58" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:416 name: Dipyrrolylmethanemethyl def: "Dipyrrolylmethanemethyl." [RESID:AA0252, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=416] xref: record_id "416" xref: delta_mono_mass "418.137616" xref: delta_avge_mass "418.3973" xref: delta_composition "H(22) C(20) N(2) O(8)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 16:33:24" xref: date_time_modified "2006-11-14 10:37:01" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:417 name: PhosphoUridine def: "Uridine phosphodiester." [RESID:AA0256, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=417] xref: record_id "417" xref: delta_mono_mass "306.025302" xref: delta_avge_mass "306.166" xref: delta_composition "H(11) C(9) N(2) O(8) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 16:38:18" xref: date_time_modified "2006-10-16 15:52:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:419 name: Glycerophospho def: "Glycerophospho." [RESID:AA0264, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=419] xref: record_id "419" xref: delta_mono_mass "154.00311" xref: delta_avge_mass "154.0584" xref: delta_composition "H(7) C(3) O(5) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:02:51" xref: date_time_modified "2006-10-16 14:03:40" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:420 name: Carboxy->Thiocarboxy def: "Thiocarboxylic acid." [FindMod:THIOG, RESID:AA0265, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=420] xref: record_id "420" xref: delta_mono_mass "15.977156" xref: delta_avge_mass "16.0656" xref: delta_composition "O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:08:53" xref: date_time_modified "2006-10-14 10:59:20" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:421 name: Sulfide def: "Persulfide." [RESID:AA0269, URL:http\://www.nestgrp.com/protocols/bmt/pi3tr.shtml, FindMod:CYSP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=421] xref: record_id "421" xref: delta_mono_mass "31.972071" xref: delta_avge_mass "32.065" xref: delta_composition "S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:22:45" xref: date_time_modified "2012-11-23 11:25:27" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_2_misc_notes "beta-thiolation" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "W" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_misc_notes "Addition of a single sulfur atom by Pi3-Tryptophan reagent to create thiol" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:422 name: PyruvicAcidIminyl def: "N-pyruvic acid 2-iminyl." [RESID:AA0287, RESID:AA0274, RESID:AA0275, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=422] xref: record_id "422" xref: delta_mono_mass "70.005479" xref: delta_avge_mass "70.0468" xref: delta_composition "H(2) C(3) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:30:48" xref: date_time_modified "2006-10-16 10:35:08" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "V" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:423 name: Delta:Se(1) def: "Selenyl." [RESID:AA0277, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=423] xref: record_id "423" xref: delta_mono_mass "79.91652" xref: delta_avge_mass "78.96" xref: delta_composition "Se" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:49:48" xref: date_time_modified "2006-10-16 11:14:44" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:424 name: MolybdopterinGD def: "Molybdenum bis(molybdopterin guanine dinucleotide)." [RESID:AA0375, RESID:AA0281, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=424] xref: record_id "424" xref: delta_mono_mass "1572.985775" xref: delta_avge_mass "1572.0146" xref: delta_composition "H(47) C(40) N(20) O(26) P(4) S(4) Mo" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:53:48" xref: date_time_modified "2016-02-01 14:23:12" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "U" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:425 name: Dioxidation def: "Dihydroxy." [PMID:9252331, RESID:AA0282, RESID:AA0370, FindMod:DIHYDR, FindMod:MSONE, FindMod:CSIA, PMID:12686488, RESID:AA0262, RESID:AA0369, RESID:AA0263, RESID:AA0251, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=425] xref: record_id "425" xref: delta_mono_mass "31.989829" xref: delta_avge_mass "31.9988" xref: delta_composition "O(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 17:59:33" xref: date_time_modified "2017-11-03 09:33:41" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_4_group "4" xref: spec_4_hidden "0" xref: spec_4_site "M" xref: spec_4_position "Anywhere" xref: spec_4_classification "Post-translational" xref: spec_4_misc_notes "Sulphone" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "F" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_5_misc_notes "phenylalanine oxidation to dihydroxyphenylalanine" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "W" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_6_misc_notes "tryptophan oxidation to formylkynurenin" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "Y" xref: spec_7_position "Anywhere" xref: spec_7_classification "Post-translational" xref: spec_7_misc_notes "trihydroxyphenylalanine" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "C" xref: spec_8_position "Anywhere" xref: spec_8_classification "Post-translational" xref: spec_8_misc_notes "sulfinic acid" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "U" xref: spec_9_position "Anywhere" xref: spec_9_classification "Multiple" xref: spec_10_group "10" xref: spec_10_hidden "1" xref: spec_10_site "E" xref: spec_10_position "Anywhere" xref: spec_10_classification "Chemical derivative" xref: spec_11_group "11" xref: spec_11_hidden "1" xref: spec_11_site "I" xref: spec_11_position "Anywhere" xref: spec_11_classification "Chemical derivative" xref: spec_12_group "12" xref: spec_12_hidden "1" xref: spec_12_site "L" xref: spec_12_position "Anywhere" xref: spec_12_classification "Chemical derivative" xref: spec_13_group "13" xref: spec_13_hidden "1" xref: spec_13_site "V" xref: spec_13_position "Anywhere" xref: spec_13_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:426 name: Octanoyl def: "Octanoyl." [RESID:AA0290, RESID:AA0386, FindMod:OCTA, RESID:AA0584, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=426] xref: record_id "426" xref: delta_mono_mass "126.104465" xref: delta_avge_mass "126.1962" xref: delta_composition "H(14) C(8) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 18:04:46" xref: date_time_modified "2013-03-07 10:09:12" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:428 name: PhosphoHexNAc def: "N-acetylglucosamine-1-phosphoryl." [RESID:AA0296, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=428] xref: record_id "428" xref: delta_mono_mass "283.045704" xref: delta_avge_mass "283.1724" xref: delta_composition "H O(3) P HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 18:15:16" xref: date_time_modified "2015-05-01 15:11:15" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_284_mono_mass "283.045704" xref: spec_1_neutral_loss_284_avge_mass "283.1724" xref: spec_1_neutral_loss_284_flag "false" xref: spec_1_neutral_loss_284_composition "H O(3) P HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_284_mono_mass "283.045704" xref: spec_1_neutral_loss_284_avge_mass "283.1724" xref: spec_1_neutral_loss_284_flag "false" xref: spec_1_neutral_loss_284_composition "H O(3) P HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:429 name: PhosphoHex def: "Phosphoglycosyl-D-mannose-1-phosphoryl." [RESID:AA0297, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=429] xref: record_id "429" xref: delta_mono_mass "242.019154" xref: delta_avge_mass "242.1205" xref: delta_composition "H O(3) P Hex" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 18:18:51" xref: date_time_modified "2015-05-01 15:09:57" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_243_mono_mass "242.019154" xref: spec_1_neutral_loss_243_avge_mass "242.1205" xref: spec_1_neutral_loss_243_flag "false" xref: spec_1_neutral_loss_243_composition "H O(3) P Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_243_mono_mass "242.019154" xref: spec_1_neutral_loss_243_avge_mass "242.1205" xref: spec_1_neutral_loss_243_flag "false" xref: spec_1_neutral_loss_243_composition "H O(3) P Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:431 name: Palmitoleyl def: "Palmitoleyl." [RESID:AA0308, FindMod:PALE, PMID:17141155, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=431] xref: record_id "431" xref: delta_mono_mass "236.214016" xref: delta_avge_mass "236.3929" xref: delta_composition "H(28) C(16) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 19:57:30" xref: date_time_modified "2009-06-21 21:18:50" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Pre-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:432 name: Cholesterol def: "Cholesterol ester." [RESID:AA0309, FindMod:CHOL, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=432] xref: record_id "432" xref: delta_mono_mass "368.344302" xref: delta_avge_mass "368.6383" xref: delta_composition "H(44) C(27)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:00:10" xref: date_time_modified "2006-10-16 16:36:21" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:433 name: Didehydroretinylidene def: "3,4-didehydroretinylidene." [RESID:AA0312, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=433] xref: record_id "433" xref: delta_mono_mass "264.187801" xref: delta_avge_mass "264.4046" xref: delta_composition "H(24) C(20)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:05:19" xref: date_time_modified "2006-10-16 15:46:50" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:434 name: CHDH def: "Cis-14-hydroxy-10,13-dioxo-7-heptadecenoic ester." [RESID:AA0316, FindMod:CHDH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=434] xref: record_id "434" xref: delta_mono_mass "294.183109" xref: delta_avge_mass "294.3859" xref: delta_composition "H(26) C(17) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:08:49" xref: date_time_modified "2006-10-16 15:49:28" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:435 name: Methylpyrroline def: "4-methyl-delta-1-pyrroline-5-carboxyl." [RESID:AA0321, FindMod:PYRK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=435] xref: record_id "435" xref: delta_mono_mass "109.052764" xref: delta_avge_mass "109.1259" xref: delta_composition "H(7) C(6) N O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:21:00" xref: date_time_modified "2006-10-16 13:37:33" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:436 name: Hydroxyheme def: "Hydroxyheme." [RESID:AA0324, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=436] xref: record_id "436" xref: delta_mono_mass "614.161645" xref: delta_avge_mass "614.4714" xref: delta_composition "H(30) C(34) N(4) O(4) Fe" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:29:16" xref: date_time_modified "2006-10-16 17:10:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:437 name: MicrocinC7 def: "(3-aminopropyl)(L-aspartyl-1-amino)phosphoryl-5-adenosine." [RESID:AA0328, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=437] xref: record_id "437" xref: delta_mono_mass "386.110369" xref: delta_avge_mass "386.3003" xref: delta_composition "H(19) C(13) N(6) O(6) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:36:37" xref: date_time_modified "2006-10-16 16:40:21" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:438 name: Cyano def: "Cyano." [RESID:AA0333, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=438] xref: record_id "438" xref: delta_mono_mass "24.995249" xref: delta_avge_mass "25.0095" xref: delta_composition "H(-1) C N" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:42:40" xref: date_time_modified "2006-10-14 19:43:48" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:439 name: Diironsubcluster def: "Hydrogenase diiron subcluster." [RESID:AA0334, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=439] xref: record_id "439" xref: delta_mono_mass "342.786916" xref: delta_avge_mass "342.876" xref: delta_composition "H(-1) C(5) N(2) O(5) S(2) Fe(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:46:03" xref: date_time_modified "2006-10-16 16:01:22" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:440 name: Amidino def: "Amidino." [RESID:AA0335, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=440] xref: record_id "440" xref: delta_mono_mass "42.021798" xref: delta_avge_mass "42.04" xref: delta_composition "H(2) C N(2)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 20:49:10" xref: date_time_modified "2006-10-15 19:58:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:442 name: FMN def: "O3-(riboflavin phosphoryl)." [RESID:AA0350, RESID:AA0349, FindMod:FMN, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=442] xref: record_id "442" xref: delta_mono_mass "438.094051" xref: delta_avge_mass "438.3285" xref: delta_composition "H(19) C(17) N(4) O(8) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 21:11:32" xref: date_time_modified "2006-10-16 16:47:27" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:443 name: FMNC def: "S-(4a-FMN)." [RESID:AA0351, FindMod:FMNC, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=443] xref: record_id "443" xref: delta_mono_mass "456.104615" xref: delta_avge_mass "456.3438" xref: delta_composition "H(21) C(17) N(4) O(9) P" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 21:21:47" xref: date_time_modified "2006-10-16 16:58:10" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:444 name: CuSMo def: "Copper sulfido molybdopterin cytosine dinuncleotide." [RESID:AA0355, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=444] xref: record_id "444" xref: delta_mono_mass "922.834855" xref: delta_avge_mass "922.067" xref: delta_composition "H(24) C(19) N(8) O(15) P(2) S(3) Cu Mo" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 21:34:38" xref: date_time_modified "2006-10-16 17:20:14" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:445 name: Hydroxytrimethyl def: "5-hydroxy-N6,N6,N6-trimethyl." [RESID:AA0359, FindMod:TRIMETK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=445] xref: record_id "445" xref: delta_mono_mass "59.04969" xref: delta_avge_mass "59.0871" xref: delta_composition "H(7) C(3) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 21:40:08" xref: date_time_modified "2006-10-16 10:28:02" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:447 name: Deoxy def: "Reduction." [RESID:AA0191, PMID:14235557, RESID:AA0373, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=447] synonym: "Serine to Alanine Threonine to a-aminobutyrate" [] xref: record_id "447" xref: delta_mono_mass "-15.994915" xref: delta_avge_mass "-15.9994" xref: delta_composition "O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 22:00:35" xref: date_time_modified "2006-10-13 17:16:30" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "Beta elimination of O-glycosylation under alkaline conditions followed by reduction" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_misc_notes "Beta elimination of O-glycosylation under alkaline conditions followed by reduction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:448 name: Microcin def: "Microcin E492 siderophore ester from serine." [RESID:AA0374, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=448] xref: record_id "448" xref: delta_mono_mass "831.197041" xref: delta_avge_mass "831.6871" xref: delta_composition "H(37) C(36) N(3) O(20)" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 22:04:46" xref: date_time_modified "2006-10-16 17:18:24" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:449 name: Decanoyl def: "Lipid." [RESID:AA0387, RESID:AA0385, FindMod:DECA, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=449] xref: record_id "449" xref: delta_mono_mass "154.135765" xref: delta_avge_mass "154.2493" xref: delta_composition "H(18) C(10) O" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2005-10-15 22:14:11" xref: date_time_modified "2006-10-16 14:04:24" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:450 name: Glu def: "Monoglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=450] xref: record_id "450" xref: delta_mono_mass "129.042593" xref: delta_avge_mass "129.114" xref: delta_composition "H(7) C(5) N O(3)" xref: username_of_poster "vcavett" xref: group_of_poster "users" xref: date_time_posted "2005-10-18 15:07:18" xref: date_time_modified "2006-10-17 13:48:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:451 name: GluGlu def: "Diglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=451] xref: record_id "451" xref: delta_mono_mass "258.085186" xref: delta_avge_mass "258.228" xref: delta_composition "H(14) C(10) N(2) O(6)" xref: username_of_poster "vcavett" xref: group_of_poster "users" xref: date_time_posted "2005-10-18 15:17:59" xref: date_time_modified "2006-10-17 13:49:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:452 name: GluGluGlu def: "Triglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=452] xref: record_id "452" xref: delta_mono_mass "387.127779" xref: delta_avge_mass "387.3419" xref: delta_composition "H(21) C(15) N(3) O(9)" xref: username_of_poster "vcavett" xref: group_of_poster "users" xref: date_time_posted "2005-10-18 15:21:01" xref: date_time_modified "2006-10-17 14:11:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:453 name: GluGluGluGlu def: "Tetraglutamyl." [PMID:12356754, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=453] xref: record_id "453" xref: delta_mono_mass "516.170373" xref: delta_avge_mass "516.4559" xref: delta_composition "H(28) C(20) N(4) O(12)" xref: username_of_poster "vcavett" xref: group_of_poster "users" xref: date_time_posted "2005-10-18 15:22:24" xref: date_time_modified "2006-10-17 14:16:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Protein C-term" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:454 name: HexN def: "Hexosamine." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=454] synonym: "Glucosamine Galactosamine" [] xref: record_id "454" xref: delta_mono_mass "161.068808" xref: delta_avge_mass "161.1558" xref: delta_composition "HexN" xref: username_of_poster "xyuan" xref: group_of_poster "users" xref: date_time_posted "2005-11-08 18:58:20" xref: date_time_modified "2015-05-01 16:57:37" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Synth. pep. protect. gp." xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_162_mono_mass "161.068808" xref: spec_2_neutral_loss_162_avge_mass "161.1558" xref: spec_2_neutral_loss_162_flag "false" xref: spec_2_neutral_loss_162_composition "HexN" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "O-linked glycosylation" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_162_mono_mass "161.068808" xref: spec_3_neutral_loss_162_avge_mass "161.1558" xref: spec_3_neutral_loss_162_flag "false" xref: spec_3_neutral_loss_162_composition "HexN" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "O-linked glycosylation" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_162_mono_mass "161.068808" xref: spec_3_neutral_loss_162_avge_mass "161.1558" xref: spec_3_neutral_loss_162_flag "false" xref: spec_3_neutral_loss_162_composition "HexN" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "W" xref: spec_4_position "Anywhere" xref: spec_4_classification "Other glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:455 name: Xlink:DMP[154] def: "Free monolink of DMP crosslinker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011314_ImidoesterCrsLnk_DMA_DMP_DMS_DTBP_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=455] synonym: "Dimethyl pimelimidate" [] xref: record_id "455" xref: delta_mono_mass "154.110613" xref: delta_avge_mass "154.2096" xref: delta_composition "H(14) C(8) N(2) O" xref: username_of_poster "mariana" xref: group_of_poster "users" xref: date_time_posted "2005-11-08 20:09:24" xref: date_time_modified "2017-08-18 10:27:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:457 name: NDA def: "Naphthalene-2,3-dicarboxaldehyde." [PMID:2081203, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=457] comment: Fluorescent derivative. xref: record_id "457" xref: delta_mono_mass "175.042199" xref: delta_avge_mass "175.1855" xref: delta_composition "H(5) C(13) N" xref: username_of_poster "Dekker" xref: group_of_poster "users" xref: date_time_posted "2005-11-11 11:03:32" xref: date_time_modified "2006-10-17 13:41:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:464 name: SPITC:13C(6) def: "4-sulfophenyl isothiocyanate (Heavy C13)." [PMID:16526082, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=464] synonym: "N-terminal / lysine sulfonation" [] xref: record_id "464" xref: delta_mono_mass "220.991213" xref: delta_avge_mass "221.2054" xref: delta_composition "H(5) C 13C(6) N O(3) S(2)" xref: username_of_poster "apanchaud" xref: group_of_poster "users" xref: date_time_posted "2005-12-19 08:37:57" xref: date_time_modified "2006-10-16 15:25:36" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:472 name: AEC-MAEC def: "Aminoethylcysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=472] comment: Modification procedure used for phosphopeptide mapping. synonym: "beta-methylaminoethylcysteine" [] xref: record_id "472" xref: delta_mono_mass "59.019355" xref: delta_avge_mass "59.1334" xref: delta_composition "H(5) C(2) N O(-1) S" xref: username_of_poster "mpcusack" xref: group_of_poster "users" xref: date_time_posted "2006-01-20 00:46:08" xref: date_time_modified "2007-09-26 22:43:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "pS gives aminoethylcysteine" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "pT gives beta-methylaminoethylcysteine" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:476 name: TMAB def: "4-trimethyllammoniumbutyryl-." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=476] xref: record_id "476" xref: delta_mono_mass "128.107539" xref: delta_avge_mass "128.1922" xref: delta_composition "H(14) C(7) N O" xref: username_of_poster "xwei" xref: group_of_poster "users" xref: date_time_posted "2006-02-15 03:10:16" xref: date_time_modified "2006-10-17 12:08:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_neutral_loss_60_mono_mass "59.073499" xref: spec_1_neutral_loss_60_avge_mass "59.1103" xref: spec_1_neutral_loss_60_flag "false" xref: spec_1_neutral_loss_60_composition "H(9) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_neutral_loss_60_mono_mass "59.073499" xref: spec_2_neutral_loss_60_avge_mass "59.1103" xref: spec_2_neutral_loss_60_flag "false" xref: spec_2_neutral_loss_60_composition "H(9) C(3) N" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:477 name: TMAB:2H(9) def: "D9-4-trimethyllammoniumbutyryl-." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=477] xref: record_id "477" xref: delta_mono_mass "137.16403" xref: delta_avge_mass "137.2476" xref: delta_composition "H(5) 2H(9) C(7) N O" xref: username_of_poster "xwei" xref: group_of_poster "users" xref: date_time_posted "2006-02-15 18:36:06" xref: date_time_modified "2006-10-17 12:08:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_neutral_loss_69_mono_mass "68.12999" xref: spec_1_neutral_loss_69_avge_mass "68.1657" xref: spec_1_neutral_loss_69_flag "false" xref: spec_1_neutral_loss_69_composition "2H(9) C(3) N" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_neutral_loss_69_mono_mass "68.12999" xref: spec_2_neutral_loss_69_avge_mass "68.1657" xref: spec_2_neutral_loss_69_flag "false" xref: spec_2_neutral_loss_69_composition "2H(9) C(3) N" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:478 name: FTC def: "Fluorescein-5-thiosemicarbazide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=478] xref: record_id "478" xref: delta_mono_mass "421.073241" xref: delta_avge_mass "421.4259" xref: delta_composition "H(15) C(21) N(3) O(5) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2006-02-20 11:15:03" xref: date_time_modified "2006-10-16 16:45:27" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "P" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:481 name: Label:2H(4) def: "4,4,5,5-D4 Lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=481] comment: For SILAC experiments. synonym: "Alanine-2,3,3,3-d4" [] xref: record_id "481" xref: delta_mono_mass "4.025107" xref: delta_avge_mass "4.0246" xref: delta_composition "H(-4) 2H(4)" xref: username_of_poster "yunwah" xref: group_of_poster "users" xref: date_time_posted "2006-02-20 11:44:19" xref: date_time_modified "2019-01-10 15:45:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "F" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Cambridge Labs DLM-451" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "A" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "485845 Aldrich" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "U" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:488 name: DHP def: "Dehydropyrrolizidine alkaloid (dehydroretronecine) on cysteines." [PMID:16222722, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=488] synonym: "Dehydroretronecine" [] xref: record_id "488" xref: delta_mono_mass "118.065674" xref: delta_avge_mass "118.1558" xref: delta_composition "H(8) C(8) N" xref: username_of_poster "rowanrainbow" xref: group_of_poster "users" xref: date_time_posted "2006-03-07 08:40:13" xref: date_time_modified "2006-10-17 12:07:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:490 name: Hep def: "Heptose." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=490] xref: record_id "490" xref: delta_mono_mass "192.063388" xref: delta_avge_mass "192.1666" xref: delta_composition "Hep" xref: username_of_poster "anikolakakis" xref: group_of_poster "users" xref: date_time_posted "2006-03-24 15:59:43" xref: date_time_modified "2015-05-05 15:58:34" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_193_mono_mass "192.063388" xref: spec_2_neutral_loss_193_avge_mass "192.1666" xref: spec_2_neutral_loss_193_flag "false" xref: spec_2_neutral_loss_193_composition "Hep" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Q" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other glycosylation" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "N-linked glycosylation" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "O-linked glycosylation" xref: spec_5_neutral_loss_193_mono_mass "192.063388" xref: spec_5_neutral_loss_193_avge_mass "192.1666" xref: spec_5_neutral_loss_193_flag "false" xref: spec_5_neutral_loss_193_composition "Hep" xref: spec_5_neutral_loss_0_mono_mass "0" xref: spec_5_neutral_loss_0_avge_mass "0" xref: spec_5_neutral_loss_0_flag "false" xref: spec_5_neutral_loss_0_composition "0" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "O-linked glycosylation" xref: spec_5_neutral_loss_193_mono_mass "192.063388" xref: spec_5_neutral_loss_193_avge_mass "192.1666" xref: spec_5_neutral_loss_193_flag "false" xref: spec_5_neutral_loss_193_composition "Hep" xref: spec_5_neutral_loss_0_mono_mass "0" xref: spec_5_neutral_loss_0_avge_mass "0" xref: spec_5_neutral_loss_0_flag "false" xref: spec_5_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:493 name: BADGE def: "Bisphenol A diglycidyl ether derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=493] comment: Found in canned food products. xref: record_id "493" xref: delta_mono_mass "340.167459" xref: delta_avge_mass "340.4129" xref: delta_composition "H(24) C(21) O(4)" xref: username_of_poster "TNO" xref: group_of_poster "users" xref: date_time_posted "2006-03-27 09:30:54" xref: date_time_modified "2006-10-17 14:09:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" xref: spec_1_misc_notes "found in canned food products" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:494 name: CyDye-Cy3 def: "Cy3 CyDye DIGE Fluor saturation dye." [PMID:12872219, URL:https\://www.gelifesciences.com/gehcls_images/GELS/Related Content/Files/1314735988470/litdoc28953107AD_20110831002141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=494] synonym: "Formula needs confirmation" [] xref: record_id "494" xref: delta_mono_mass "672.298156" xref: delta_avge_mass "672.8335" xref: delta_composition "H(44) C(37) N(4) O(6) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2006-03-27 11:17:51" xref: date_time_modified "2012-09-15 00:20:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:495 name: CyDye-Cy5 def: "Cy5 CyDye DIGE Fluor saturation dye." [PMID:12872219, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=495] xref: record_id "495" xref: delta_mono_mass "684.298156" xref: delta_avge_mass "684.8442" xref: delta_composition "H(44) C(38) N(4) O(6) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2006-03-27 11:53:04" xref: date_time_modified "2006-10-17 14:18:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:498 name: BHTOH def: "Michael addition of t-butyl hydroxylated BHT (BHTOH) to C, H or K." [PMID:16533022, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=498] comment: BHTOH is formed upon metabolism of BHT with P450 enzymes. The BHTOH is further metabolized to its quinone methide (electrophile) which reacts with -SH and -NH2 groups. synonym: "t-butyl hydroxylated BHT" [] xref: record_id "498" xref: delta_mono_mass "234.16198" xref: delta_avge_mass "234.334" xref: delta_composition "H(22) C(15) O(2)" xref: username_of_poster "rkupfer" xref: group_of_poster "users" xref: date_time_posted "2006-04-10 19:27:51" xref: date_time_modified "2006-10-17 13:42:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "primary adduct" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:499 name: IGBP:13C(2) def: "Heavy IDBEST tag for quantitation." [URL:http\://www.targetdiscovery.com/index.php?topic=prod.idbe, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=499] xref: record_id "499" xref: delta_mono_mass "298.022748" xref: delta_avge_mass "299.1331" xref: delta_composition "H(13) C(10) 13C(2) N(2) O(2) Br" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2006-04-14 18:44:41" xref: date_time_modified "2006-10-19 10:48:25" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:500 name: Nmethylmaleimide+water def: "Nmethylmaleimidehydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=500] xref: record_id "500" xref: delta_mono_mass "129.042593" xref: delta_avge_mass "129.114" xref: delta_composition "H(7) C(5) N O(3)" xref: username_of_poster "whaskins" xref: group_of_poster "users" xref: date_time_posted "2006-04-14 22:58:34" xref: date_time_modified "2006-10-17 12:12:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:501 name: PyMIC def: "3-methyl-2-pyridyl isocyanate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=501] xref: record_id "501" xref: delta_mono_mass "134.048013" xref: delta_avge_mass "134.1353" xref: delta_composition "H(6) C(7) N(2) O" xref: username_of_poster "TING" xref: group_of_poster "users" xref: date_time_posted "2006-04-18 20:46:17" xref: date_time_modified "2006-10-17 12:19:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:503 name: LG-lactam-K def: "Levuglandinyl - lysine lactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=503] xref: record_id "503" xref: delta_mono_mass "332.19876" xref: delta_avge_mass "332.4339" xref: delta_composition "H(28) C(20) O(4)" xref: username_of_poster "alexparf" xref: group_of_poster "users" xref: date_time_posted "2006-04-27 17:56:39" xref: date_time_modified "2006-11-14 12:04:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:504 name: LG-Hlactam-K def: "Levuglandinyl - lysine hydroxylactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=504] xref: record_id "504" xref: delta_mono_mass "348.193674" xref: delta_avge_mass "348.4333" xref: delta_composition "H(28) C(20) O(5)" xref: username_of_poster "alexparf" xref: group_of_poster "users" xref: date_time_posted "2006-04-27 18:02:17" xref: date_time_modified "2006-11-14 12:04:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:505 name: LG-lactam-R def: "Levuglandinyl - arginine lactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=505] xref: record_id "505" xref: delta_mono_mass "290.176961" xref: delta_avge_mass "290.3939" xref: delta_composition "H(26) C(19) N(-2) O(4)" xref: username_of_poster "alexparf" xref: group_of_poster "users" xref: date_time_posted "2006-04-27 18:05:11" xref: date_time_modified "2006-10-17 14:08:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:506 name: LG-Hlactam-R def: "Levuglandinyl - arginine hydroxylactam adduct." [PMID:15650407, PMID:15752459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=506] xref: record_id "506" xref: delta_mono_mass "306.171876" xref: delta_avge_mass "306.3933" xref: delta_composition "H(26) C(19) N(-2) O(5)" xref: username_of_poster "alexparf" xref: group_of_poster "users" xref: date_time_posted "2006-04-27 18:08:11" xref: date_time_modified "2006-10-17 14:08:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:510 name: Dimethyl:2H(4)13C(2) def: "DiMethyl-C13HD2." [PMID:16335955, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=510] xref: record_id "510" xref: delta_mono_mass "34.063117" xref: delta_avge_mass "34.0631" xref: delta_composition "2H(4) 13C(2)" xref: username_of_poster "oded" xref: group_of_poster "users" xref: date_time_posted "2006-05-08 22:03:41" xref: date_time_modified "2014-11-16 07:37:20" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Protein N-term" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "When dimethyl labelling is pre-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:512 name: Hex(2) def: "Lactosylation." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=512] comment: Lactosylation of bovine Beta-Lactoglobulin. synonym: "lac" [] xref: record_id "512" xref: delta_mono_mass "324.105647" xref: delta_avge_mass "324.2812" xref: delta_composition "Hex(2)" xref: username_of_poster "molle" xref: group_of_poster "users" xref: date_time_posted "2006-05-11 13:21:17" xref: date_time_modified "2017-11-23 12:59:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_1_misc_notes "Maillard reaction (first event)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Other glycosylation" xref: spec_2_misc_notes "Maillard reaction (first event)" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "O-linked glycosylation" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_325_mono_mass "324.105647" xref: spec_3_neutral_loss_325_avge_mass "324.2812" xref: spec_3_neutral_loss_325_flag "false" xref: spec_3_neutral_loss_325_composition "Hex(2)" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "O-linked glycosylation" xref: spec_3_neutral_loss_0_mono_mass "0" xref: spec_3_neutral_loss_0_avge_mass "0" xref: spec_3_neutral_loss_0_flag "false" xref: spec_3_neutral_loss_0_composition "0" xref: spec_3_neutral_loss_325_mono_mass "324.105647" xref: spec_3_neutral_loss_325_avge_mass "324.2812" xref: spec_3_neutral_loss_325_flag "false" xref: spec_3_neutral_loss_325_composition "Hex(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:513 name: C8-QAT def: "[3-(2,5)-Dioxopyrrolidin-1-yloxycarbonyl)-propyl]dimethyloctylammonium." [PMID:16771548, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=513] xref: record_id "513" xref: delta_mono_mass "227.224915" xref: delta_avge_mass "227.3862" xref: delta_composition "H(29) C(14) N O" xref: username_of_poster "amadian" xref: group_of_poster "users" xref: date_time_posted "2006-05-13 20:55:20" xref: date_time_modified "2006-12-03 19:43:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:514 name: PropylNAGthiazoline def: "Propyl-1,2-dideoxy-2\'-methyl-alpha-D-glucopyranoso-[2,1-d]-Delta2\'-thiazoline." [PMID:15795231, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=514] comment: In a recent publication (see reference), we have shown that family 84 glycoside hydrolases contain a deep pocket beneath the 2-acetamido group of its substrate (N-acetyl-glucosamine). With this strucual feature in mind, we have designed a specific inhibitor that contains a chloride group appended to the end of the propyl chain on a known inhibitor termed propyl-NAG-thiazoline. We have shown kinetically that this molecule is a potent suicide inhibitor of this enzyme famiy and now wish to know the precise residue which is acting as the nucleophile to dispace the choride atom. We have included all residues that are in the vacinity of the chloride atom that could potentially act in a nucleophilic manner. xref: record_id "514" xref: delta_mono_mass "232.064354" xref: delta_avge_mass "232.2768" xref: delta_composition "H(14) C(9) N O(4) S" xref: username_of_poster "mmacaule" xref: group_of_poster "users" xref: date_time_posted "2006-05-18 18:44:52" xref: date_time_modified "2015-05-01 13:33:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:515 name: FNEM def: "Fluorescein-5-maleimide." [PMID:9325338, PMID:11665566, URL:http\://probes.invitrogen.com/media/pis/mp00003.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=515] synonym: "fluorescein-NEM" [] xref: record_id "515" xref: delta_mono_mass "427.069202" xref: delta_avge_mass "427.3625" xref: delta_composition "H(13) C(24) N O(7)" xref: username_of_poster "shure" xref: group_of_poster "users" xref: date_time_posted "2006-06-08 10:07:56" xref: date_time_modified "2006-10-17 14:15:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "photosensitive" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:518 name: Diethyl def: "Diethylation, analogous to Dimethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=518] xref: record_id "518" xref: delta_mono_mass "56.0626" xref: delta_avge_mass "56.1063" xref: delta_composition "H(8) C(4)" xref: username_of_poster "PhilipHsu" xref: group_of_poster "users" xref: date_time_posted "2006-06-15 07:18:26" xref: date_time_modified "2006-10-17 12:00:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:519 name: BisANS def: "4,4\'-dianilino-1,1\'-binaphthyl-5,5\'-disulfonic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=519] xref: record_id "519" xref: delta_mono_mass "594.091928" xref: delta_avge_mass "594.6569" xref: delta_composition "H(22) C(32) N(2) O(6) S(2)" xref: username_of_poster "app95d" xref: group_of_poster "users" xref: date_time_posted "2006-07-05 23:31:08" xref: date_time_modified "2012-05-15 20:15:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:520 name: Piperidine def: "Piperidination." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=520] xref: record_id "520" xref: delta_mono_mass "68.0626" xref: delta_avge_mass "68.117" xref: delta_composition "H(8) C(5)" xref: username_of_poster "PhilipHsu" xref: group_of_poster "users" xref: date_time_posted "2006-07-20 08:37:21" xref: date_time_modified "2006-10-17 12:05:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:522 name: Maleimide-PEO2-Biotin def: "Maleimide-Biotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031005, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=522] synonym: "Maleimide-PEG2-Biotin" [] xref: record_id "522" xref: delta_mono_mass "525.225719" xref: delta_avge_mass "525.6183" xref: delta_composition "H(35) C(23) N(5) O(7) S" xref: username_of_poster "ericjohansen" xref: group_of_poster "users" xref: date_time_posted "2006-08-11 02:49:51" xref: date_time_modified "2010-12-03 16:13:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:523 name: Sulfo-NHS-LC-LC-Biotin def: "Biot_LC_LC." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=8D38BA83-EFDC-421A-853F-E96EBA380612, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=523] synonym: "Sulfo-NHS-LC-LC-Biotin" [] xref: record_id "523" xref: delta_mono_mass "452.245726" xref: delta_avge_mass "452.6106" xref: delta_composition "H(36) C(22) N(4) O(4) S" xref: username_of_poster "unimod" xref: group_of_poster "admin" xref: date_time_posted "2006-08-31 18:01:50" xref: date_time_modified "2010-12-03 16:11:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:525 name: CLIP_TRAQ_2 def: "CLIP_TRAQ_2." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=525] comment: CLIP-TRAQ-2 H(17) C(10) C13 N(3) O(4) is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 141.0983 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 113 or 114 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation). synonym: "CLIP_TRAQ_double" [] xref: record_id "525" xref: delta_mono_mass "141.098318" xref: delta_avge_mass "141.1756" xref: delta_composition "H(12) C(6) 13C N(2) O" xref: username_of_poster "overalllab" xref: group_of_poster "users" xref: date_time_posted "2006-09-15 02:25:46" xref: date_time_modified "2006-10-17 18:04:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Side reaction, low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:526 name: Dethiomethyl def: "Prompt loss of side chain from oxidised Met." [PMID:9004526, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=526] comment: More commonly seen as a neutral loss. xref: record_id "526" xref: delta_mono_mass "-48.003371" xref: delta_avge_mass "-48.1075" xref: delta_composition "H(-4) C(-1) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-13 15:14:55" xref: date_time_modified "2006-10-13 17:02:27" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:528 name: Methyl+Deamidated def: "Deamidation followed by a methylation." [FindMod:DEAME, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=528] synonym: "Glutamate methyl ester" [] xref: record_id "528" xref: delta_mono_mass "14.999666" xref: delta_avge_mass "15.0113" xref: delta_composition "H C N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-14 10:39:08" xref: date_time_modified "2007-02-04 12:25:42" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:529 name: Delta:H(5)C(2) def: "Dimethylation of proline residue." [FindMod:DIMETP, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=529] xref: record_id "529" xref: delta_mono_mass "29.039125" xref: delta_avge_mass "29.0611" xref: delta_composition "H(5) C(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-15 18:02:34" xref: date_time_modified "2006-10-15 18:03:16" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:530 name: Cation:K def: "Replacement of proton by potassium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=530] xref: record_id "530" xref: delta_mono_mass "37.955882" xref: delta_avge_mass "38.0904" xref: delta_composition "H(-1) K" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-15 18:29:43" xref: date_time_modified "2006-10-18 11:17:39" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:531 name: Cation:Cu[I] def: "Replacement of proton by copper." [URL:http\://www.uniprot.org/uniprot/P07509, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=531] xref: record_id "531" xref: delta_mono_mass "61.921774" xref: delta_avge_mass "62.5381" xref: delta_composition "H(-1) Cu" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-16 10:29:12" xref: date_time_modified "2015-03-19 09:33:03" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "H" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:532 name: iTRAQ4plex114 def: "Accurate mass for 114." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=532] comment: Different channels have the same nominal mass but slightly different exact masses. synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" [] xref: record_id "532" xref: delta_mono_mass "144.105918" xref: delta_avge_mass "144.168" xref: delta_composition "H(12) C(5) 13C(2) N(2) 18O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-16 13:46:49" xref: date_time_modified "2017-11-09 09:36:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "C" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "side reaction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:533 name: iTRAQ4plex115 def: "Accurate mass for 115." [URL:http\://docs.appliedbiosystems.com/pebiodocs/04351918.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=533] comment: Different channels have the same nominal mass but slightly different exact masses. synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" [] xref: record_id "533" xref: delta_mono_mass "144.099599" xref: delta_avge_mass "144.1688" xref: delta_composition "H(12) C(6) 13C N 15N 18O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-16 13:48:16" xref: date_time_modified "2017-11-09 09:34:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "C" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "side reaction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:534 name: Dibromo def: "Dibromo." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=534] xref: record_id "534" xref: delta_mono_mass "155.821022" xref: delta_avge_mass "157.7921" xref: delta_composition "H(-2) Br(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-16 14:06:38" xref: date_time_modified "2006-10-16 14:06:38" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:535 name: LRGG def: "Ubiquitination." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=535] synonym: "Addition of LRGG" [] xref: record_id "535" xref: delta_mono_mass "383.228103" xref: delta_avge_mass "383.446" xref: delta_composition "H(29) C(16) N(7) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-10-16 16:39:05" xref: date_time_modified "2014-07-09 16:48:40" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:536 name: CLIP_TRAQ_3 def: "CLIP_TRAQ_3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=536] comment: CLIP_TRAQ_3 (H(20) C(11) C13 N(3) O(4) is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 155.1 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 127 or 128 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation). xref: record_id "536" xref: delta_mono_mass "271.148736" xref: delta_avge_mass "271.2976" xref: delta_composition "H(20) C(11) 13C N(3) O(4)" xref: username_of_poster "overall" xref: group_of_poster "" xref: date_time_posted "2006-10-17 18:08:00" xref: date_time_modified "2006-10-17 18:11:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:537 name: CLIP_TRAQ_4 def: "CLIP_TRAQ_4." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=537] comment: CLIP_TRAQ_4 is an in-house made compound that reacts with primary amines through a N-hydroxysuccinimide group leading to a 128.1 Da mass shift (monoisotopic) in MS mode. The reporter ion in MS/MS mode can either be 100 or 101 m/z depending on the position of isotopic C13 in the molecule. (Fahlman, R. and Overall, C.M. ; in preparation). xref: record_id "537" xref: delta_mono_mass "244.101452" xref: delta_avge_mass "244.2292" xref: delta_composition "H(15) C(9) 13C N(2) O(5)" xref: username_of_poster "overall" xref: group_of_poster "" xref: date_time_posted "2006-10-17 18:09:22" xref: date_time_modified "2006-10-17 18:10:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:538 name: Biotin:Cayman-10141 def: "Was 15dB-biotin." [URL:http\://www.caymanchem.com/pdfs/10141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=538] synonym: "15-deoxy-delta 12,14-Prostaglandin J2-biotinimide" [] xref: record_id "538" xref: delta_mono_mass "626.386577" xref: delta_avge_mass "626.8927" xref: delta_composition "H(54) C(35) N(4) O(4) S" xref: username_of_poster "sevgh" xref: group_of_poster "" xref: date_time_posted "2006-10-17 18:13:45" xref: date_time_modified "2010-12-03 16:08:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:539 name: Biotin:Cayman-10013 def: "Was PGA1-biotin." [URL:http\://www.caymanchem.com/pdfs/10013.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=539] synonym: "Prostaglandin A1-biotinimide" [] xref: record_id "539" xref: delta_mono_mass "660.428442" xref: delta_avge_mass "660.9504" xref: delta_composition "H(60) C(36) N(4) O(5) S" xref: username_of_poster "sevgh" xref: group_of_poster "" xref: date_time_posted "2006-10-17 18:24:06" xref: date_time_modified "2010-12-03 16:07:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:540 name: Ala->Ser def: "Ala->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=540] xref: record_id "540" xref: delta_mono_mass "15.994915" xref: delta_avge_mass "15.9994" xref: delta_composition "O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:07:30" xref: date_time_modified "2006-11-09 10:07:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:541 name: Ala->Thr def: "Ala->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=541] xref: record_id "541" xref: delta_mono_mass "30.010565" xref: delta_avge_mass "30.026" xref: delta_composition "H(2) C O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:13:43" xref: date_time_modified "2006-11-09 10:13:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:542 name: Ala->Asp def: "Ala->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=542] xref: record_id "542" xref: delta_mono_mass "43.989829" xref: delta_avge_mass "44.0095" xref: delta_composition "C O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:15:05" xref: date_time_modified "2006-11-09 10:15:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:543 name: Ala->Pro def: "Ala->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=543] xref: record_id "543" xref: delta_mono_mass "26.01565" xref: delta_avge_mass "26.0373" xref: delta_composition "H(2) C(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:16:03" xref: date_time_modified "2006-11-09 10:16:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:544 name: Ala->Gly def: "Ala->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=544] xref: record_id "544" xref: delta_mono_mass "-14.01565" xref: delta_avge_mass "-14.0266" xref: delta_composition "H(-2) C(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:16:35" xref: date_time_modified "2006-11-09 10:16:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:545 name: Ala->Glu def: "Ala->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=545] xref: record_id "545" xref: delta_mono_mass "58.005479" xref: delta_avge_mass "58.0361" xref: delta_composition "H(2) C(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:19:56" xref: date_time_modified "2006-11-09 10:19:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:546 name: Ala->Val def: "Ala->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=546] xref: record_id "546" xref: delta_mono_mass "28.0313" xref: delta_avge_mass "28.0532" xref: delta_composition "H(4) C(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:20:15" xref: date_time_modified "2006-11-09 10:20:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:547 name: Cys->Phe def: "Cys->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=547] xref: record_id "547" xref: delta_mono_mass "44.059229" xref: delta_avge_mass "44.031" xref: delta_composition "H(4) C(6) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:20:41" xref: date_time_modified "2006-11-09 10:20:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:548 name: Cys->Ser def: "Cys->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=548] xref: record_id "548" xref: delta_mono_mass "-15.977156" xref: delta_avge_mass "-16.0656" xref: delta_composition "O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:21:13" xref: date_time_modified "2006-11-09 10:21:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:549 name: Cys->Trp def: "Cys->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=549] xref: record_id "549" xref: delta_mono_mass "83.070128" xref: delta_avge_mass "83.067" xref: delta_composition "H(5) C(8) N S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:21:37" xref: date_time_modified "2006-11-09 10:21:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:550 name: Cys->Tyr def: "Cys->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=550] xref: record_id "550" xref: delta_mono_mass "60.054144" xref: delta_avge_mass "60.0304" xref: delta_composition "H(4) C(6) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:22:04" xref: date_time_modified "2006-11-09 10:22:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:551 name: Cys->Arg def: "Cys->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=551] xref: record_id "551" xref: delta_mono_mass "53.091927" xref: delta_avge_mass "53.0428" xref: delta_composition "H(7) C(3) N(3) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:22:25" xref: date_time_modified "2006-11-09 10:22:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:552 name: Cys->Gly def: "Cys->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=552] xref: record_id "552" xref: delta_mono_mass "-45.987721" xref: delta_avge_mass "-46.0916" xref: delta_composition "H(-2) C(-1) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:22:43" xref: date_time_modified "2006-11-09 10:22:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:553 name: Asp->Ala def: "Asp->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=553] xref: record_id "553" xref: delta_mono_mass "-43.989829" xref: delta_avge_mass "-44.0095" xref: delta_composition "C(-1) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:53:54" xref: date_time_modified "2006-11-09 10:53:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:554 name: Asp->His def: "Asp->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=554] xref: record_id "554" xref: delta_mono_mass "22.031969" xref: delta_avge_mass "22.0519" xref: delta_composition "H(2) C(2) N(2) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:55:25" xref: date_time_modified "2006-11-09 10:55:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:555 name: Asp->Asn def: "Asp->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=555] xref: record_id "555" xref: delta_mono_mass "-0.984016" xref: delta_avge_mass "-0.9848" xref: delta_composition "H N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:55:49" xref: date_time_modified "2006-11-09 10:55:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:556 name: Asp->Gly def: "Asp->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=556] xref: record_id "556" xref: delta_mono_mass "-58.005479" xref: delta_avge_mass "-58.0361" xref: delta_composition "H(-2) C(-2) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:56:52" xref: date_time_modified "2006-11-09 10:56:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:557 name: Asp->Tyr def: "Asp->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=557] xref: record_id "557" xref: delta_mono_mass "48.036386" xref: delta_avge_mass "48.0859" xref: delta_composition "H(4) C(5) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:58:23" xref: date_time_modified "2006-11-09 10:58:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:558 name: Asp->Glu def: "Asp->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=558] xref: record_id "558" xref: delta_mono_mass "14.01565" xref: delta_avge_mass "14.0266" xref: delta_composition "H(2) C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:58:44" xref: date_time_modified "2006-11-09 10:58:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:559 name: Asp->Val def: "Asp->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=559] xref: record_id "559" xref: delta_mono_mass "-15.958529" xref: delta_avge_mass "-15.9563" xref: delta_composition "H(4) C O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 10:59:02" xref: date_time_modified "2006-11-09 10:59:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:560 name: Glu->Ala def: "Glu->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=560] xref: record_id "560" xref: delta_mono_mass "-58.005479" xref: delta_avge_mass "-58.0361" xref: delta_composition "H(-2) C(-2) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:00:54" xref: date_time_modified "2006-11-09 11:00:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:561 name: Glu->Gln def: "Glu->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=561] xref: record_id "561" xref: delta_mono_mass "-0.984016" xref: delta_avge_mass "-0.9848" xref: delta_composition "H N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:01:29" xref: date_time_modified "2006-11-09 11:01:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:562 name: Glu->Asp def: "Glu->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=562] xref: record_id "562" xref: delta_mono_mass "-14.01565" xref: delta_avge_mass "-14.0266" xref: delta_composition "H(-2) C(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:01:53" xref: date_time_modified "2006-11-09 11:01:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:563 name: Glu->Lys def: "Glu->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=563] xref: record_id "563" xref: delta_mono_mass "-0.94763" xref: delta_avge_mass "-0.9417" xref: delta_composition "H(5) C N O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:02:15" xref: date_time_modified "2006-11-09 11:02:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:564 name: Glu->Gly def: "Glu->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=564] xref: record_id "564" xref: delta_mono_mass "-72.021129" xref: delta_avge_mass "-72.0627" xref: delta_composition "H(-4) C(-3) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:02:36" xref: date_time_modified "2006-11-09 11:02:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:565 name: Glu->Val def: "Glu->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=565] xref: record_id "565" xref: delta_mono_mass "-29.974179" xref: delta_avge_mass "-29.9829" xref: delta_composition "H(2) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:03:02" xref: date_time_modified "2006-11-09 11:03:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:566 name: Phe->Ser def: "Phe->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=566] xref: record_id "566" xref: delta_mono_mass "-60.036386" xref: delta_avge_mass "-60.0966" xref: delta_composition "H(-4) C(-6) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:03:29" xref: date_time_modified "2006-11-09 11:03:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:567 name: Phe->Cys def: "Phe->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=567] xref: record_id "567" xref: delta_mono_mass "-44.059229" xref: delta_avge_mass "-44.031" xref: delta_composition "H(-4) C(-6) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:04:01" xref: date_time_modified "2006-11-09 11:04:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:568 name: Phe->Xle def: "Phe->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=568] xref: record_id "568" xref: delta_mono_mass "-33.98435" xref: delta_avge_mass "-34.0162" xref: delta_composition "H(2) C(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:05:41" xref: date_time_modified "2011-06-21 15:10:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:569 name: Phe->Tyr def: "Phe->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=569] xref: record_id "569" xref: delta_mono_mass "15.994915" xref: delta_avge_mass "15.9994" xref: delta_composition "O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:06:56" xref: date_time_modified "2006-11-09 11:06:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:570 name: Phe->Val def: "Phe->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=570] xref: record_id "570" xref: delta_mono_mass "-48" xref: delta_avge_mass "-48.0428" xref: delta_composition "C(-4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:07:20" xref: date_time_modified "2006-11-09 11:07:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:571 name: Gly->Ala def: "Gly->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=571] xref: record_id "571" xref: delta_mono_mass "14.01565" xref: delta_avge_mass "14.0266" xref: delta_composition "H(2) C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:07:51" xref: date_time_modified "2006-11-09 11:07:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:572 name: Gly->Ser def: "Gly->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=572] xref: record_id "572" xref: delta_mono_mass "30.010565" xref: delta_avge_mass "30.026" xref: delta_composition "H(2) C O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:08:13" xref: date_time_modified "2006-11-09 11:08:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:573 name: Gly->Trp def: "Gly->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=573] xref: record_id "573" xref: delta_mono_mass "129.057849" xref: delta_avge_mass "129.1586" xref: delta_composition "H(7) C(9) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:08:33" xref: date_time_modified "2006-11-09 11:08:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:574 name: Gly->Glu def: "Gly->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=574] xref: record_id "574" xref: delta_mono_mass "72.021129" xref: delta_avge_mass "72.0627" xref: delta_composition "H(4) C(3) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:08:57" xref: date_time_modified "2006-11-09 11:08:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:575 name: Gly->Val def: "Gly->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=575] xref: record_id "575" xref: delta_mono_mass "42.04695" xref: delta_avge_mass "42.0797" xref: delta_composition "H(6) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:09:18" xref: date_time_modified "2006-11-09 11:09:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:576 name: Gly->Asp def: "Gly->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=576] xref: record_id "576" xref: delta_mono_mass "58.005479" xref: delta_avge_mass "58.0361" xref: delta_composition "H(2) C(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:09:44" xref: date_time_modified "2006-11-09 11:09:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:577 name: Gly->Cys def: "Gly->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=577] xref: record_id "577" xref: delta_mono_mass "45.987721" xref: delta_avge_mass "46.0916" xref: delta_composition "H(2) C S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:10:03" xref: date_time_modified "2006-11-09 11:10:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:578 name: Gly->Arg def: "Gly->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=578] xref: record_id "578" xref: delta_mono_mass "99.079647" xref: delta_avge_mass "99.1344" xref: delta_composition "H(9) C(4) N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:10:23" xref: date_time_modified "2006-11-09 11:10:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:580 name: His->Pro def: "His->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=580] xref: record_id "580" xref: delta_mono_mass "-40.006148" xref: delta_avge_mass "-40.0241" xref: delta_composition "C(-1) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:11:29" xref: date_time_modified "2006-11-09 11:11:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:581 name: His->Tyr def: "His->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=581] xref: record_id "581" xref: delta_mono_mass "26.004417" xref: delta_avge_mass "26.034" xref: delta_composition "H(2) C(3) N(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:11:50" xref: date_time_modified "2006-11-09 11:11:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:582 name: His->Gln def: "His->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=582] xref: record_id "582" xref: delta_mono_mass "-9.000334" xref: delta_avge_mass "-9.0101" xref: delta_composition "H C(-1) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:14:42" xref: date_time_modified "2006-11-09 11:14:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:584 name: His->Arg def: "His->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=584] xref: record_id "584" xref: delta_mono_mass "19.042199" xref: delta_avge_mass "19.0464" xref: delta_composition "H(5) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:15:26" xref: date_time_modified "2006-11-09 11:15:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:585 name: His->Xle def: "His->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=585] xref: record_id "585" xref: delta_mono_mass "-23.974848" xref: delta_avge_mass "-23.9816" xref: delta_composition "H(4) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:15:51" xref: date_time_modified "2011-06-21 15:10:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:588 name: Xle->Thr def: "Leu/Ile->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=588] xref: record_id "588" xref: delta_mono_mass "-12.036386" xref: delta_avge_mass "-12.0538" xref: delta_composition "H(-4) C(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:18:09" xref: date_time_modified "2011-06-21 15:29:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "I" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "L" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:589 name: Xle->Asn def: "Leu/Ile->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=589] xref: record_id "589" xref: delta_mono_mass "0.958863" xref: delta_avge_mass "0.945" xref: delta_composition "H(-5) C(-2) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:18:31" xref: date_time_modified "2011-06-21 15:29:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "I" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "L" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:590 name: Xle->Lys def: "Leu/Ile->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=590] xref: record_id "590" xref: delta_mono_mass "15.010899" xref: delta_avge_mass "15.0146" xref: delta_composition "H N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:18:57" xref: date_time_modified "2011-06-21 15:27:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "I" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "L" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:594 name: Lys->Thr def: "Lys->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=594] xref: record_id "594" xref: delta_mono_mass "-27.047285" xref: delta_avge_mass "-27.0684" xref: delta_composition "H(-5) C(-2) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:20:28" xref: date_time_modified "2006-11-09 11:20:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:595 name: Lys->Asn def: "Lys->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=595] xref: record_id "595" xref: delta_mono_mass "-14.052036" xref: delta_avge_mass "-14.0696" xref: delta_composition "H(-6) C(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:20:51" xref: date_time_modified "2006-11-09 11:20:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:596 name: Lys->Glu def: "Lys->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=596] xref: record_id "596" xref: delta_mono_mass "0.94763" xref: delta_avge_mass "0.9417" xref: delta_composition "H(-5) C(-1) N(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:21:12" xref: date_time_modified "2006-11-09 11:21:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:597 name: Lys->Gln def: "Lys->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=597] xref: record_id "597" xref: delta_mono_mass "-0.036386" xref: delta_avge_mass "-0.0431" xref: delta_composition "H(-4) C(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:21:32" xref: date_time_modified "2006-11-09 11:21:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:598 name: Lys->Met def: "Lys->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=598] xref: record_id "598" xref: delta_mono_mass "2.945522" xref: delta_avge_mass "3.0238" xref: delta_composition "H(-3) C(-1) N(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:21:56" xref: date_time_modified "2006-11-09 11:21:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:599 name: Lys->Arg def: "Lys->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=599] xref: record_id "599" xref: delta_mono_mass "28.006148" xref: delta_avge_mass "28.0134" xref: delta_composition "N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:22:15" xref: date_time_modified "2006-11-09 11:22:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:600 name: Lys->Xle def: "Lys->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=600] xref: record_id "600" xref: delta_mono_mass "-15.010899" xref: delta_avge_mass "-15.0146" xref: delta_composition "H(-1) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:22:38" xref: date_time_modified "2011-06-21 15:25:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:601 name: Xle->Ser def: "Leu/Ile->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=601] xref: record_id "601" xref: delta_mono_mass "-26.052036" xref: delta_avge_mass "-26.0803" xref: delta_composition "H(-6) C(-3) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:23:01" xref: date_time_modified "2011-06-21 15:29:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:602 name: Xle->Phe def: "Leu/Ile->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=602] xref: record_id "602" xref: delta_mono_mass "33.98435" xref: delta_avge_mass "34.0162" xref: delta_composition "H(-2) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:23:22" xref: date_time_modified "2011-06-21 15:28:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:603 name: Xle->Trp def: "Leu/Ile->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=603] xref: record_id "603" xref: delta_mono_mass "72.995249" xref: delta_avge_mass "73.0523" xref: delta_composition "H(-1) C(5) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:23:48" xref: date_time_modified "2011-06-21 15:28:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:604 name: Xle->Pro def: "Leu/Ile->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=604] xref: record_id "604" xref: delta_mono_mass "-16.0313" xref: delta_avge_mass "-16.0425" xref: delta_composition "H(-4) C(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:24:06" xref: date_time_modified "2011-06-21 15:29:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:605 name: Xle->Val def: "Leu/Ile->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=605] xref: record_id "605" xref: delta_mono_mass "-14.01565" xref: delta_avge_mass "-14.0266" xref: delta_composition "H(-2) C(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:24:28" xref: date_time_modified "2011-06-21 15:28:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:606 name: Xle->His def: "Leu/Ile->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=606] xref: record_id "606" xref: delta_mono_mass "23.974848" xref: delta_avge_mass "23.9816" xref: delta_composition "H(-4) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:24:50" xref: date_time_modified "2011-06-21 15:29:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:607 name: Xle->Gln def: "Leu/Ile->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=607] xref: record_id "607" xref: delta_mono_mass "14.974514" xref: delta_avge_mass "14.9716" xref: delta_composition "H(-3) C(-1) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:25:14" xref: date_time_modified "2011-06-21 15:29:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:608 name: Xle->Met def: "Leu/Ile->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=608] xref: record_id "608" xref: delta_mono_mass "17.956421" xref: delta_avge_mass "18.0384" xref: delta_composition "H(-2) C(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:25:59" xref: date_time_modified "2011-06-21 15:28:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:609 name: Xle->Arg def: "Leu/Ile->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=609] xref: record_id "609" xref: delta_mono_mass "43.017047" xref: delta_avge_mass "43.028" xref: delta_composition "H N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:26:21" xref: date_time_modified "2011-06-21 15:28:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:610 name: Met->Thr def: "Met->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=610] xref: record_id "610" xref: delta_mono_mass "-29.992806" xref: delta_avge_mass "-30.0922" xref: delta_composition "H(-2) C(-1) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:26:47" xref: date_time_modified "2006-11-09 11:26:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:611 name: Met->Arg def: "Met->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=611] xref: record_id "611" xref: delta_mono_mass "25.060626" xref: delta_avge_mass "24.9896" xref: delta_composition "H(3) C N(3) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:27:10" xref: date_time_modified "2006-11-09 11:27:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:613 name: Met->Lys def: "Met->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=613] xref: record_id "613" xref: delta_mono_mass "-2.945522" xref: delta_avge_mass "-3.0238" xref: delta_composition "H(3) C N S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:28:29" xref: date_time_modified "2006-11-09 11:28:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:614 name: Met->Xle def: "Met->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=614] synonym: "Also Met->norleucine" [] xref: record_id "614" xref: delta_mono_mass "-17.956421" xref: delta_avge_mass "-18.0384" xref: delta_composition "H(2) C S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:28:56" xref: date_time_modified "2018-02-28 16:07:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:615 name: Met->Val def: "Met->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=615] xref: record_id "615" xref: delta_mono_mass "-31.972071" xref: delta_avge_mass "-32.065" xref: delta_composition "S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:29:27" xref: date_time_modified "2006-11-09 11:29:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:616 name: Asn->Ser def: "Asn->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=616] xref: record_id "616" xref: delta_mono_mass "-27.010899" xref: delta_avge_mass "-27.0253" xref: delta_composition "H(-1) C(-1) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:29:57" xref: date_time_modified "2006-11-09 11:29:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:617 name: Asn->Thr def: "Asn->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=617] xref: record_id "617" xref: delta_mono_mass "-12.995249" xref: delta_avge_mass "-12.9988" xref: delta_composition "H N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:34:11" xref: date_time_modified "2006-11-09 11:34:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:618 name: Asn->Lys def: "Asn->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=618] xref: record_id "618" xref: delta_mono_mass "14.052036" xref: delta_avge_mass "14.0696" xref: delta_composition "H(6) C(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:34:31" xref: date_time_modified "2006-11-09 11:34:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:619 name: Asn->Tyr def: "Asn->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=619] xref: record_id "619" xref: delta_mono_mass "49.020401" xref: delta_avge_mass "49.0706" xref: delta_composition "H(3) C(5) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:34:56" xref: date_time_modified "2006-11-09 11:34:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:620 name: Asn->His def: "Asn->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=620] xref: record_id "620" xref: delta_mono_mass "23.015984" xref: delta_avge_mass "23.0366" xref: delta_composition "H C(2) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:35:18" xref: date_time_modified "2006-11-09 11:35:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:621 name: Asn->Asp def: "Asn->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=621] xref: record_id "621" xref: delta_mono_mass "0.984016" xref: delta_avge_mass "0.9848" xref: delta_composition "H(-1) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:35:42" xref: date_time_modified "2006-11-09 11:35:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:622 name: Asn->Xle def: "Asn->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=622] xref: record_id "622" xref: delta_mono_mass "-0.958863" xref: delta_avge_mass "-0.945" xref: delta_composition "H(5) C(2) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:36:02" xref: date_time_modified "2011-06-21 15:13:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:623 name: Pro->Ser def: "Pro->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=623] xref: record_id "623" xref: delta_mono_mass "-10.020735" xref: delta_avge_mass "-10.0379" xref: delta_composition "H(-2) C(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:36:26" xref: date_time_modified "2006-11-09 11:36:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:624 name: Pro->Ala def: "Pro->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=624] xref: record_id "624" xref: delta_mono_mass "-26.01565" xref: delta_avge_mass "-26.0373" xref: delta_composition "H(-2) C(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:37:56" xref: date_time_modified "2006-11-09 11:37:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:625 name: Pro->His def: "Pro->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=625] xref: record_id "625" xref: delta_mono_mass "40.006148" xref: delta_avge_mass "40.0241" xref: delta_composition "C N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:38:18" xref: date_time_modified "2006-11-09 11:38:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:626 name: Pro->Gln def: "Pro->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=626] xref: record_id "626" xref: delta_mono_mass "31.005814" xref: delta_avge_mass "31.014" xref: delta_composition "H N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:38:40" xref: date_time_modified "2006-11-09 11:38:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:627 name: Pro->Thr def: "Pro->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=627] xref: record_id "627" xref: delta_mono_mass "3.994915" xref: delta_avge_mass "3.9887" xref: delta_composition "C(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:39:02" xref: date_time_modified "2006-11-09 11:39:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:628 name: Pro->Arg def: "Pro->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=628] xref: record_id "628" xref: delta_mono_mass "59.048347" xref: delta_avge_mass "59.0705" xref: delta_composition "H(5) C N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:39:29" xref: date_time_modified "2006-11-09 11:39:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:629 name: Pro->Xle def: "Pro->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=629] xref: record_id "629" xref: delta_mono_mass "16.0313" xref: delta_avge_mass "16.0425" xref: delta_composition "H(4) C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:39:47" xref: date_time_modified "2011-06-21 15:09:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:630 name: Gln->Pro def: "Gln->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=630] xref: record_id "630" xref: delta_mono_mass "-31.005814" xref: delta_avge_mass "-31.014" xref: delta_composition "H(-1) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:40:19" xref: date_time_modified "2006-11-09 11:40:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:631 name: Gln->Lys def: "Gln->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=631] xref: record_id "631" xref: delta_mono_mass "0.036386" xref: delta_avge_mass "0.0431" xref: delta_composition "H(4) C O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:42:17" xref: date_time_modified "2006-11-09 11:42:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:632 name: Gln->Glu def: "Gln->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=632] xref: record_id "632" xref: delta_mono_mass "0.984016" xref: delta_avge_mass "0.9848" xref: delta_composition "H(-1) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:42:38" xref: date_time_modified "2006-11-09 11:42:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:633 name: Gln->His def: "Gln->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=633] xref: record_id "633" xref: delta_mono_mass "9.000334" xref: delta_avge_mass "9.0101" xref: delta_composition "H(-1) C N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:42:58" xref: date_time_modified "2006-11-09 11:42:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:634 name: Gln->Arg def: "Gln->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=634] xref: record_id "634" xref: delta_mono_mass "28.042534" xref: delta_avge_mass "28.0565" xref: delta_composition "H(4) C N(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:43:25" xref: date_time_modified "2006-11-09 11:43:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:635 name: Gln->Xle def: "Gln->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=635] xref: record_id "635" xref: delta_mono_mass "-14.974514" xref: delta_avge_mass "-14.9716" xref: delta_composition "H(3) C N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:43:47" xref: date_time_modified "2011-06-21 15:09:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:636 name: Arg->Ser def: "Arg->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=636] xref: record_id "636" xref: delta_mono_mass "-69.069083" xref: delta_avge_mass "-69.1084" xref: delta_composition "H(-7) C(-3) N(-3) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:44:13" xref: date_time_modified "2006-11-09 11:44:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:637 name: Arg->Trp def: "Arg->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=637] xref: record_id "637" xref: delta_mono_mass "29.978202" xref: delta_avge_mass "30.0242" xref: delta_composition "H(-2) C(5) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:44:36" xref: date_time_modified "2006-11-09 11:44:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:638 name: Arg->Thr def: "Arg->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=638] xref: record_id "638" xref: delta_mono_mass "-55.053433" xref: delta_avge_mass "-55.0818" xref: delta_composition "H(-5) C(-2) N(-3) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:44:59" xref: date_time_modified "2006-11-09 11:44:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:639 name: Arg->Pro def: "Arg->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=639] xref: record_id "639" xref: delta_mono_mass "-59.048347" xref: delta_avge_mass "-59.0705" xref: delta_composition "H(-5) C(-1) N(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:45:18" xref: date_time_modified "2006-11-09 11:45:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:640 name: Arg->Lys def: "Arg->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=640] xref: record_id "640" xref: delta_mono_mass "-28.006148" xref: delta_avge_mass "-28.0134" xref: delta_composition "N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:45:37" xref: date_time_modified "2006-11-09 11:45:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:641 name: Arg->His def: "Arg->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=641] xref: record_id "641" xref: delta_mono_mass "-19.042199" xref: delta_avge_mass "-19.0464" xref: delta_composition "H(-5) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:45:56" xref: date_time_modified "2006-11-09 11:45:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:642 name: Arg->Gln def: "Arg->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=642] xref: record_id "642" xref: delta_mono_mass "-28.042534" xref: delta_avge_mass "-28.0565" xref: delta_composition "H(-4) C(-1) N(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:46:17" xref: date_time_modified "2006-11-09 11:46:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:643 name: Arg->Met def: "Arg->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=643] xref: record_id "643" xref: delta_mono_mass "-25.060626" xref: delta_avge_mass "-24.9896" xref: delta_composition "H(-3) C(-1) N(-3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:46:37" xref: date_time_modified "2006-11-09 11:46:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:644 name: Arg->Cys def: "Arg->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=644] xref: record_id "644" xref: delta_mono_mass "-53.091927" xref: delta_avge_mass "-53.0428" xref: delta_composition "H(-7) C(-3) N(-3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:47:00" xref: date_time_modified "2006-11-09 11:47:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:645 name: Arg->Xle def: "Arg->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=645] xref: record_id "645" xref: delta_mono_mass "-43.017047" xref: delta_avge_mass "-43.028" xref: delta_composition "H(-1) N(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:47:36" xref: date_time_modified "2011-06-21 15:09:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:646 name: Arg->Gly def: "Arg->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=646] xref: record_id "646" xref: delta_mono_mass "-99.079647" xref: delta_avge_mass "-99.1344" xref: delta_composition "H(-9) C(-4) N(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 11:48:00" xref: date_time_modified "2006-11-09 11:48:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:647 name: Ser->Phe def: "Ser->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=647] xref: record_id "647" xref: delta_mono_mass "60.036386" xref: delta_avge_mass "60.0966" xref: delta_composition "H(4) C(6) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:32:55" xref: date_time_modified "2006-11-09 12:32:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:648 name: Ser->Ala def: "Ser->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=648] xref: record_id "648" xref: delta_mono_mass "-15.994915" xref: delta_avge_mass "-15.9994" xref: delta_composition "O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:33:14" xref: date_time_modified "2006-11-09 12:33:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:649 name: Ser->Trp def: "Ser->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=649] xref: record_id "649" xref: delta_mono_mass "99.047285" xref: delta_avge_mass "99.1326" xref: delta_composition "H(5) C(8) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:33:32" xref: date_time_modified "2006-11-09 12:33:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:650 name: Ser->Thr def: "Ser->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=650] xref: record_id "650" xref: delta_mono_mass "14.01565" xref: delta_avge_mass "14.0266" xref: delta_composition "H(2) C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:33:51" xref: date_time_modified "2006-11-09 12:33:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:651 name: Ser->Asn def: "Ser->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=651] xref: record_id "651" xref: delta_mono_mass "27.010899" xref: delta_avge_mass "27.0253" xref: delta_composition "H C N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:34:12" xref: date_time_modified "2006-11-09 12:34:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:652 name: Ser->Pro def: "Ser->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=652] xref: record_id "652" xref: delta_mono_mass "10.020735" xref: delta_avge_mass "10.0379" xref: delta_composition "H(2) C(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:34:34" xref: date_time_modified "2006-11-09 12:34:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:653 name: Ser->Tyr def: "Ser->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=653] xref: record_id "653" xref: delta_mono_mass "76.0313" xref: delta_avge_mass "76.096" xref: delta_composition "H(4) C(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:35:00" xref: date_time_modified "2006-11-09 12:35:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:654 name: Ser->Cys def: "Ser->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=654] xref: record_id "654" xref: delta_mono_mass "15.977156" xref: delta_avge_mass "16.0656" xref: delta_composition "O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:35:22" xref: date_time_modified "2006-11-09 12:35:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:655 name: Ser->Arg def: "Ser->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=655] xref: record_id "655" xref: delta_mono_mass "69.069083" xref: delta_avge_mass "69.1084" xref: delta_composition "H(7) C(3) N(3) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:35:40" xref: date_time_modified "2006-11-09 12:35:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:656 name: Ser->Xle def: "Ser->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=656] xref: record_id "656" xref: delta_mono_mass "26.052036" xref: delta_avge_mass "26.0803" xref: delta_composition "H(6) C(3) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:36:10" xref: date_time_modified "2011-06-21 15:08:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:657 name: Ser->Gly def: "Ser->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=657] xref: record_id "657" xref: delta_mono_mass "-30.010565" xref: delta_avge_mass "-30.026" xref: delta_composition "H(-2) C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:36:34" xref: date_time_modified "2006-11-09 12:36:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:658 name: Thr->Ser def: "Thr->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=658] xref: record_id "658" xref: delta_mono_mass "-14.01565" xref: delta_avge_mass "-14.0266" xref: delta_composition "H(-2) C(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:36:57" xref: date_time_modified "2006-11-09 12:36:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:659 name: Thr->Ala def: "Thr->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=659] xref: record_id "659" xref: delta_mono_mass "-30.010565" xref: delta_avge_mass "-30.026" xref: delta_composition "H(-2) C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:37:15" xref: date_time_modified "2006-11-09 12:37:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:660 name: Thr->Asn def: "Thr->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=660] xref: record_id "660" xref: delta_mono_mass "12.995249" xref: delta_avge_mass "12.9988" xref: delta_composition "H(-1) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:37:37" xref: date_time_modified "2006-11-09 12:37:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:661 name: Thr->Lys def: "Thr->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=661] xref: record_id "661" xref: delta_mono_mass "27.047285" xref: delta_avge_mass "27.0684" xref: delta_composition "H(5) C(2) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:37:55" xref: date_time_modified "2006-11-09 12:37:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:662 name: Thr->Pro def: "Thr->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=662] xref: record_id "662" xref: delta_mono_mass "-3.994915" xref: delta_avge_mass "-3.9887" xref: delta_composition "C O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:38:14" xref: date_time_modified "2006-11-09 12:38:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:663 name: Thr->Met def: "Thr->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=663] xref: record_id "663" xref: delta_mono_mass "29.992806" xref: delta_avge_mass "30.0922" xref: delta_composition "H(2) C O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:38:34" xref: date_time_modified "2006-11-09 12:38:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:664 name: Thr->Xle def: "Thr->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=664] xref: record_id "664" xref: delta_mono_mass "12.036386" xref: delta_avge_mass "12.0538" xref: delta_composition "H(4) C(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:38:56" xref: date_time_modified "2011-06-21 15:25:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:665 name: Thr->Arg def: "Thr->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=665] xref: record_id "665" xref: delta_mono_mass "55.053433" xref: delta_avge_mass "55.0818" xref: delta_composition "H(5) C(2) N(3) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:39:14" xref: date_time_modified "2006-11-09 12:39:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:666 name: Val->Phe def: "Val->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=666] xref: record_id "666" xref: delta_mono_mass "48" xref: delta_avge_mass "48.0428" xref: delta_composition "C(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:39:35" xref: date_time_modified "2006-11-09 12:39:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:667 name: Val->Ala def: "Val->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=667] xref: record_id "667" xref: delta_mono_mass "-28.0313" xref: delta_avge_mass "-28.0532" xref: delta_composition "H(-4) C(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:40:00" xref: date_time_modified "2006-11-09 12:40:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:668 name: Val->Glu def: "Val->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=668] xref: record_id "668" xref: delta_mono_mass "29.974179" xref: delta_avge_mass "29.9829" xref: delta_composition "H(-2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:40:19" xref: date_time_modified "2006-11-09 12:40:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:669 name: Val->Met def: "Val->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=669] xref: record_id "669" xref: delta_mono_mass "31.972071" xref: delta_avge_mass "32.065" xref: delta_composition "S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:40:36" xref: date_time_modified "2006-11-09 12:40:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:670 name: Val->Asp def: "Val->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=670] xref: record_id "670" xref: delta_mono_mass "15.958529" xref: delta_avge_mass "15.9563" xref: delta_composition "H(-4) C(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:41:04" xref: date_time_modified "2006-11-09 12:41:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:671 name: Val->Xle def: "Val->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=671] xref: record_id "671" xref: delta_mono_mass "14.01565" xref: delta_avge_mass "14.0266" xref: delta_composition "H(2) C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:41:27" xref: date_time_modified "2011-06-21 15:08:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:672 name: Val->Gly def: "Val->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=672] xref: record_id "672" xref: delta_mono_mass "-42.04695" xref: delta_avge_mass "-42.0797" xref: delta_composition "H(-6) C(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:41:45" xref: date_time_modified "2006-11-09 12:41:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:673 name: Trp->Ser def: "Trp->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=673] xref: record_id "673" xref: delta_mono_mass "-99.047285" xref: delta_avge_mass "-99.1326" xref: delta_composition "H(-5) C(-8) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:42:22" xref: date_time_modified "2006-11-09 12:42:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:674 name: Trp->Cys def: "Trp->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=674] xref: record_id "674" xref: delta_mono_mass "-83.070128" xref: delta_avge_mass "-83.067" xref: delta_composition "H(-5) C(-8) N(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:42:46" xref: date_time_modified "2006-11-09 12:42:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:675 name: Trp->Arg def: "Trp->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=675] xref: record_id "675" xref: delta_mono_mass "-29.978202" xref: delta_avge_mass "-30.0242" xref: delta_composition "H(2) C(-5) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:43:10" xref: date_time_modified "2006-11-09 12:43:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:676 name: Trp->Gly def: "Trp->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=676] xref: record_id "676" xref: delta_mono_mass "-129.057849" xref: delta_avge_mass "-129.1586" xref: delta_composition "H(-7) C(-9) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:43:29" xref: date_time_modified "2006-11-09 12:43:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:677 name: Trp->Xle def: "Trp->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=677] xref: record_id "677" xref: delta_mono_mass "-72.995249" xref: delta_avge_mass "-73.0523" xref: delta_composition "H C(-5) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:43:49" xref: date_time_modified "2011-06-21 15:08:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:678 name: Tyr->Phe def: "Tyr->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=678] xref: record_id "678" xref: delta_mono_mass "-15.994915" xref: delta_avge_mass "-15.9994" xref: delta_composition "O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:44:13" xref: date_time_modified "2006-11-09 12:44:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:679 name: Tyr->Ser def: "Tyr->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=679] xref: record_id "679" xref: delta_mono_mass "-76.0313" xref: delta_avge_mass "-76.096" xref: delta_composition "H(-4) C(-6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:44:37" xref: date_time_modified "2006-11-09 12:44:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:680 name: Tyr->Asn def: "Tyr->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=680] xref: record_id "680" xref: delta_mono_mass "-49.020401" xref: delta_avge_mass "-49.0706" xref: delta_composition "H(-3) C(-5) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:44:59" xref: date_time_modified "2006-11-09 12:44:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:681 name: Tyr->His def: "Tyr->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=681] xref: record_id "681" xref: delta_mono_mass "-26.004417" xref: delta_avge_mass "-26.034" xref: delta_composition "H(-2) C(-3) N(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:45:22" xref: date_time_modified "2006-11-09 12:45:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:682 name: Tyr->Asp def: "Tyr->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=682] xref: record_id "682" xref: delta_mono_mass "-48.036386" xref: delta_avge_mass "-48.0859" xref: delta_composition "H(-4) C(-5) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:45:44" xref: date_time_modified "2006-11-09 12:45:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:683 name: Tyr->Cys def: "Tyr->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=683] xref: record_id "683" xref: delta_mono_mass "-60.054144" xref: delta_avge_mass "-60.0304" xref: delta_composition "H(-4) C(-6) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-09 12:46:03" xref: date_time_modified "2006-11-09 12:46:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:684 name: BDMAPP def: "Mass Defect Tag on lysine e-amino." [URL:http\://www.targetdiscovery.com/article.php?topic=crpc.prst&story=20060321132643690, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=684] xref: record_id "684" xref: delta_mono_mass "253.010225" xref: delta_avge_mass "254.1231" xref: delta_composition "H(12) C(11) N O Br" xref: username_of_poster "LVSchneid" xref: group_of_poster "" xref: date_time_posted "2006-11-13 18:51:11" xref: date_time_modified "2006-11-13 18:52:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "Low efficiency" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" xref: spec_4_misc_notes "Low efficiency" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "W" xref: spec_5_position "Anywhere" xref: spec_5_classification "Artefact" xref: spec_5_misc_notes "Low efficiency" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:685 name: NA-LNO2 def: "Nitroalkylation by Nitro Linoleic Acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=685] comment: Reversible post-translational modification of proteins by nitrated fatty acids. synonym: "Michael addition of nitro-linoleic acid to Cys and His" [] xref: record_id "685" xref: delta_mono_mass "325.225309" xref: delta_avge_mass "325.443" xref: delta_composition "H(31) C(18) N O(4)" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2006-11-13 18:59:35" xref: date_time_modified "2006-11-13 18:59:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:686 name: NA-OA-NO2 def: "Nitroalkylation by Nitro Oleic Acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=686] comment: Reversible post-translational modification of proteins by nitrated fatty acids. synonym: "Michael addition of nitro-oleic acid to Cys and His" [] xref: record_id "686" xref: delta_mono_mass "327.240959" xref: delta_avge_mass "327.4589" xref: delta_composition "H(33) C(18) N O(4)" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2006-11-13 19:01:33" xref: date_time_modified "2006-11-13 19:01:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:687 name: ICPL:2H(4) def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, medium form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, PMID:15602776, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=687] comment: Attention: As the digest is typically applied AFTER ICPL_light/heavy labeling, only ProteinN-term labeling and Lys-specific labeling is applied. xref: record_id "687" xref: delta_mono_mass "109.046571" xref: delta_avge_mass "109.1188" xref: delta_composition "H(-1) 2H(4) C(6) N O" xref: username_of_poster "suckau" xref: group_of_poster "" xref: date_time_posted "2006-11-13 19:05:12" xref: date_time_modified "2008-09-03 15:26:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "Use when labelling pre-digest" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Use when labelling post-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:695 name: Label:13C(6)15N(1) def: "13C(6) 15N(1) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=695] xref: record_id "695" xref: delta_mono_mass "7.017164" xref: delta_avge_mass "6.9493" xref: delta_composition "C(-6) 13C(6) N(-1) 15N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2006-11-29 15:10:53" xref: date_time_modified "2007-08-22 18:30:49" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:696 name: Label:2H(9)13C(6)15N(2) def: "13C(6) 15N(2) (D)9 SILAC label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, URL:http\://www.isotope.com/cil/products/displayproduct.cfm?prod_id=8635, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=696] synonym: "heavy D9 lysine" [] xref: record_id "696" xref: delta_mono_mass "17.07069" xref: delta_avge_mass "16.9982" xref: delta_composition "H(-9) 2H(9) C(-6) 13C(6) N(-2) 15N(2)" xref: username_of_poster "striker2000" xref: group_of_poster "" xref: date_time_posted "2006-12-01 22:36:25" xref: date_time_modified "2007-08-22 18:48:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:697 name: NIC def: "Nicotinic Acid." [PMID:15004565, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=697] xref: record_id "697" xref: delta_mono_mass "105.021464" xref: delta_avge_mass "105.0941" xref: delta_composition "H(3) C(6) N O" xref: username_of_poster "verena-meyer" xref: group_of_poster "" xref: date_time_posted "2006-12-04 16:04:56" xref: date_time_modified "2014-07-09 16:57:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:698 name: dNIC def: "Deuterated Nicotinic Acid." [PMID:15004565, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=698] xref: record_id "698" xref: delta_mono_mass "109.048119" xref: delta_avge_mass "109.1205" xref: delta_composition "H 2H(3) C(6) N O" xref: username_of_poster "verena-meyer" xref: group_of_poster "" xref: date_time_posted "2006-12-04 16:12:54" xref: date_time_modified "2014-07-09 16:57:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:720 name: HNE-Delta:H(2)O def: "Dehydrated 4-hydroxynonenal." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=720] comment: Mass Spectroscopic Characterization of Protein Modification by 4-Hydroxy-2-(E)-nonenal and 4-Oxo-2-(E)-nonenal. xref: record_id "720" xref: delta_mono_mass "138.104465" xref: delta_avge_mass "138.2069" xref: delta_composition "H(14) C(9) O" xref: username_of_poster "stewartb" xref: group_of_poster "" xref: date_time_posted "2007-01-08 18:29:46" xref: date_time_modified "2007-01-21 18:27:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:721 name: 4-ONE def: "4-Oxononenal (ONE)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=721] comment: Covalent adduction of nucleophilic amino acids by 4-hydroxynonenal and 4-oxononenal. xref: record_id "721" xref: delta_mono_mass "154.09938" xref: delta_avge_mass "154.2063" xref: delta_composition "H(14) C(9) O(2)" xref: username_of_poster "stewartb" xref: group_of_poster "" xref: date_time_posted "2007-01-08 19:41:28" xref: date_time_modified "2007-01-21 18:26:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:723 name: O-Dimethylphosphate def: "O-Dimethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=723] xref: record_id "723" xref: delta_mono_mass "107.997631" xref: delta_avge_mass "108.0331" xref: delta_composition "H(5) C(2) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-09 21:25:28" xref: date_time_modified "2007-01-13 21:01:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:724 name: O-Methylphosphate def: "O-Methylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=724] comment: Created by auto-catalytic dealkylation of the O-Dimethylphosphate adduct. xref: record_id "724" xref: delta_mono_mass "93.981981" xref: delta_avge_mass "94.0065" xref: delta_composition "H(3) C O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-09 21:35:38" xref: date_time_modified "2007-01-21 18:13:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:725 name: Diethylphosphate def: "O-Diethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=725] xref: record_id "725" xref: delta_mono_mass "136.028931" xref: delta_avge_mass "136.0862" xref: delta_composition "H(9) C(4) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-09 21:44:04" xref: date_time_modified "2011-12-05 16:15:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "K" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "C" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "H" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "N-term" xref: spec_7_position "Any N-term" xref: spec_7_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:726 name: Ethylphosphate def: "O-Ethylphosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=726] comment: Created by auto-catalytic dealkylation of the O-Diethylphosphate adduct. xref: record_id "726" xref: delta_mono_mass "107.997631" xref: delta_avge_mass "108.0331" xref: delta_composition "H(5) C(2) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-09 21:46:17" xref: date_time_modified "2011-12-05 16:15:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "K" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Any N-term" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:727 name: O-pinacolylmethylphosphonate def: "O-pinacolylmethylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=727] xref: record_id "727" xref: delta_mono_mass "162.080967" xref: delta_avge_mass "162.1666" xref: delta_composition "H(15) C(7) O(2) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-10 16:04:46" xref: date_time_modified "2010-04-29 08:38:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "K" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:728 name: Methylphosphonate def: "Methylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=728] comment: Created by auto-catalytic dealkylation of either the O-pinacolylmethylphosphonate adduct, or the O-isopropylmethylphosphonate adduct. xref: record_id "728" xref: delta_mono_mass "77.987066" xref: delta_avge_mass "78.0071" xref: delta_composition "H(3) C O(2) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-10 16:07:37" xref: date_time_modified "2007-01-21 18:11:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:729 name: O-Isopropylmethylphosphonate def: "O-Isopropylmethylphosphonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=729] xref: record_id "729" xref: delta_mono_mass "120.034017" xref: delta_avge_mass "120.0868" xref: delta_composition "H(9) C(4) O(2) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2007-01-10 16:10:55" xref: date_time_modified "2007-01-13 21:02:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:730 name: iTRAQ8plex def: "Representative mass and accurate mass for 113, 114, 116 & 117." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=730] comment: Other 4 channels have the same nominal mass but slightly different exact mass. For quantitation purposes, use this entry for all channels. synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry AKA iTRAQ8plex:13C(7)15N(1)" [] xref: record_id "730" xref: delta_mono_mass "304.20536" xref: delta_avge_mass "304.3074" xref: delta_composition "H(24) C(7) 13C(7) N(3) 15N O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2007-01-11 09:53:13" xref: date_time_modified "2017-11-09 09:38:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Very low abundance" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "Very low abundance" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_6_misc_notes "Very low abundance" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "N-term" xref: spec_7_position "Protein N-term" xref: spec_7_classification "Isotopic label" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "C" xref: spec_8_position "Anywhere" xref: spec_8_classification "Isotopic label" xref: spec_8_misc_notes "side reaction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:731 name: iTRAQ8plex:13C(6)15N(2) def: "Accurate mass for 115, 118, 119 & 121." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=731] comment: Other 4 channels have the same nominal mass but slightly different exact mass. For quantitation purposes, use iTRAQ8plex for all channels. synonym: "Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry" [] xref: record_id "731" xref: delta_mono_mass "304.19904" xref: delta_avge_mass "304.3081" xref: delta_composition "H(24) C(8) 13C(6) N(2) 15N(2) O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2007-01-11 09:56:21" xref: date_time_modified "2017-11-09 09:37:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "C" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "side reaction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:734 name: Ethanolamine def: "Carboxyl modification with ethanolamine." [PMID:2, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=734] comment: Carbodiimide mediated blocking of free carboxylic acids (Asp/Glu sidechains and C-termini) with ethanolamine; reaction yields an amide-bond between the carboxylic acid of the peptide/protein and the primary amine of ethanolamine; reaction irreversibly modifies carboxylic acids. Shown above is the composition of the mass adduct, after substraction of water. xref: record_id "734" xref: delta_mono_mass "43.042199" xref: delta_avge_mass "43.0678" xref: delta_composition "H(5) C(2) N" xref: username_of_poster "overalllab" xref: group_of_poster "" xref: date_time_posted "2007-01-31 22:04:44" xref: date_time_modified "2012-11-01 12:02:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "C" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:735 name: BEMAD_ST def: "Beta elimination of modified S or T followed by Michael addition of DTT." [PMID:15648052, PMID:17116471, PMID:12438562, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=735] comment: Beta-elimination and Michael addition of dithiothreitol (DTT) to serine and threonine adds a weight of approximately 136.2. synonym: "threo-1,4-dimercaptobutane-2,3-diol Was DTT_ST" [] xref: record_id "735" xref: delta_mono_mass "136.001656" xref: delta_avge_mass "136.2357" xref: delta_composition "H(8) C(4) O S(2)" xref: username_of_poster "stephenaw777" xref: group_of_poster "" xref: date_time_posted "2007-02-10 00:00:43" xref: date_time_modified "2017-06-15 14:01:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "The addition of DTT adds 136.2 not 154.2 to Serine due to loss of water in reaction" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "The addition of DTT adds 136.2 not 154.2 to Threonine due to loss of water in reaction" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:736 name: BEMAD_C def: "Beta elimination of alkylated Cys followed by Michael addition of DTT." [PMID:12438562, PMID:17116471, PMID:16452088, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=736] comment: When the beta-elimination and Michael addition of dithiothreitol (DTT) (BEMAD) reaction is used with alkylated cysteine a sulfur group is lost leaving the addition of approximately 120.2 in the chemical reaction. synonym: "Was DTT_C" [] xref: record_id "736" xref: delta_mono_mass "120.0245" xref: delta_avge_mass "120.1701" xref: delta_composition "H(8) C(4) O(2) S" xref: username_of_poster "stephenaw777" xref: group_of_poster "" xref: date_time_posted "2007-02-10 03:12:41" xref: date_time_modified "2017-06-15 13:58:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:737 name: TMT6plex def: "Sixplex Tandem Mass Tag®." [URL:https\://www.piercenet.com/instructions/2162073.pdf, URL:http\://www.piercenet.com/instructions/2162457.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=737] comment: M/z values of the TMT® fragment ions to be quantified for 6plex and 10plex: 126.12773 127.12476 128.13443 129.13147 130.14114 131.13818. Additional m/z values for 10plex: 127.13108 128.12811 129.13779 130.13482. synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. Also applies to TMT10plex Tandem Mass Tag sixplex labelling kit Proteome Sciences This is a nominal. representative mass" [] xref: record_id "737" xref: delta_mono_mass "229.162932" xref: delta_avge_mass "229.2634" xref: delta_composition "H(20) C(8) 13C(4) N 15N O(2)" xref: username_of_poster "JUergen.schaefer" xref: group_of_poster "" xref: date_time_posted "2007-03-01 13:44:23" xref: date_time_modified "2014-11-08 15:20:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:738 name: TMT2plex def: "Duplex Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=738] comment: Duplex-TMT® reagents 2TMT-126, 2TMT-127. m/z values of the TMT® fragment ions to be quantified: 126.12773 127.13108. synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. Tandem Mass Tag Duplex labelling kit Proteome Sciences" [] xref: record_id "738" xref: delta_mono_mass "225.155833" xref: delta_avge_mass "225.2921" xref: delta_composition "H(20) C(11) 13C N(2) O(2)" xref: username_of_poster "JUergen.schaefer" xref: group_of_poster "" xref: date_time_posted "2007-03-01 13:53:36" xref: date_time_modified "2014-11-08 15:19:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:739 name: TMT def: "Native Tandem Mass Tag®." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=739] comment: This modification describes the \"native\" TMT Reagent without isotopic label. synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] xref: record_id "739" xref: delta_mono_mass "224.152478" xref: delta_avge_mass "224.2994" xref: delta_composition "H(20) C(12) N(2) O(2)" xref: username_of_poster "JUergen.schaefer" xref: group_of_poster "" xref: date_time_posted "2007-03-02 09:29:50" xref: date_time_modified "2011-11-25 11:15:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:740 name: ExacTagThiol def: "ExacTag Thiol label mass for 2-4-7-10 plex." [URL:http\://www.perkinelmer.com/exactag, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=740] comment: Accurate mass for Exactag Thiol labels. synonym: "PerkinElmer ExacTag Thiol kit" [] xref: record_id "740" xref: delta_mono_mass "972.365219" xref: delta_avge_mass "972.7268" xref: delta_composition "H(50) C(23) 13C(12) N(8) 15N(6) O(18)" xref: username_of_poster "cparman" xref: group_of_poster "" xref: date_time_posted "2007-03-02 17:24:48" xref: date_time_modified "2017-10-09 15:48:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:741 name: ExacTagAmine def: "ExacTag Amine label mass for 2-4-7-10 plex." [URL:http\://www.perkinelmer.com/exactag, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=741] comment: Accurate mass for Exactag Amine labels. Includes the mass of the conjugation reagent. synonym: "PerkinElmer ExacTag Amine kit" [] xref: record_id "741" xref: delta_mono_mass "1046.347854" xref: delta_avge_mass "1046.8285" xref: delta_composition "H(52) C(25) 13C(12) N(8) 15N(6) O(19) S" xref: username_of_poster "cparman" xref: group_of_poster "" xref: date_time_posted "2007-03-02 17:28:02" xref: date_time_modified "2017-10-09 15:48:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:743 name: 4-ONE+Delta:H(-2)O(-1) def: "Dehydrated 4-Oxononenal Michael adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=743] comment: Mass Spectorscopic Characterization of Protein Modification by 4-hydroxy-2-(E)-nonenal and 4-oxo-2-(E)-nonenal. xref: record_id "743" xref: delta_mono_mass "136.088815" xref: delta_avge_mass "136.191" xref: delta_composition "H(12) C(9) O" xref: username_of_poster "stewartb" xref: group_of_poster "" xref: date_time_posted "2007-03-21 21:21:34" xref: date_time_modified "2007-04-08 18:56:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:744 name: NO_SMX_SEMD def: "Nitroso Sulfamethoxazole Sulphenamide thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=744] comment: Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity. xref: record_id "744" xref: delta_mono_mass "252.044287" xref: delta_avge_mass "252.2697" xref: delta_composition "H(10) C(10) N(3) O(3) S" xref: username_of_poster "stewartb" xref: group_of_poster "" xref: date_time_posted "2007-04-17 23:28:29" xref: date_time_modified "2007-04-21 16:55:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:745 name: NO_SMX_SMCT def: "Nitroso Sulfamethoxazole semimercaptal thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=745] comment: Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity. xref: record_id "745" xref: delta_mono_mass "268.039202" xref: delta_avge_mass "268.2691" xref: delta_composition "H(10) C(10) N(3) O(4) S" xref: username_of_poster "stewartb" xref: group_of_poster "" xref: date_time_posted "2007-04-18 21:37:48" xref: date_time_modified "2007-04-21 16:56:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:746 name: NO_SMX_SIMD def: "Nitroso Sulfamethoxazole Sulfinamide thiol adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=746] comment: Synthesis and Reactions of Nitroso Sulphamethoxazole with Biological Nucleophiles: Implications for Immune Mediated Toxicity. xref: record_id "746" xref: delta_mono_mass "267.031377" xref: delta_avge_mass "267.2612" xref: delta_composition "H(9) C(10) N(3) O(4) S" xref: username_of_poster "stewartb" xref: group_of_poster "" xref: date_time_posted "2007-04-18 21:39:11" xref: date_time_modified "2007-04-21 16:56:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:747 name: Malonyl def: "Malonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=747] xref: record_id "747" xref: delta_mono_mass "86.000394" xref: delta_avge_mass "86.0462" xref: delta_composition "H(2) C(3) O(3)" xref: username_of_poster "massy" xref: group_of_poster "" xref: date_time_posted "2007-05-17 14:17:42" xref: date_time_modified "2017-04-03 10:51:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:748 name: 3sulfo def: "Derivatization by N-term modification using 3-Sulfobenzoic succinimidyl ester." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=748] xref: record_id "748" xref: delta_mono_mass "183.983029" xref: delta_avge_mass "184.1693" xref: delta_composition "H(4) C(7) O(4) S" xref: username_of_poster "MaxWis" xref: group_of_poster "" xref: date_time_posted "2007-05-31 10:15:48" xref: date_time_modified "2007-06-24 19:58:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:750 name: trifluoro def: "Trifluoroleucine replacement of leucine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=750] xref: record_id "750" xref: delta_mono_mass "53.971735" xref: delta_avge_mass "53.9714" xref: delta_composition "H(-3) F(3)" xref: username_of_poster "UKMSF" xref: group_of_poster "" xref: date_time_posted "2007-06-13 17:10:33" xref: date_time_modified "2007-06-24 19:56:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:751 name: TNBS def: "Tri nitro benzene." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=751] xref: record_id "751" xref: delta_mono_mass "210.986535" xref: delta_avge_mass "211.0886" xref: delta_composition "H C(6) N(3) O(6)" xref: username_of_poster "DelphineP" xref: group_of_poster "" xref: date_time_posted "2007-06-21 13:36:03" xref: date_time_modified "2007-06-24 19:58:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:762 name: IDEnT def: "Isotope Distribution Encoded Tag." [PMID:10740847, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=762] comment: Modified peptides identified by isotope pattern. Restriction to cysteine-containing peptides combined with high mass accuracy allows peptide identification. synonym: "2,4-dichlorobenzylcarbamidomethyl" [] xref: record_id "762" xref: delta_mono_mass "214.990469" xref: delta_avge_mass "216.064" xref: delta_composition "H(7) C(9) N O Cl(2)" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2007-07-10 20:14:50" xref: date_time_modified "2007-07-15 20:04:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:763 name: BEMAD_ST:2H(6) def: "Beta elimination of modified S or T followed by Michael addition of labelled DTT." [PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=763] comment: Can be used for quantitative analysis of O-linked post-translational modifications. Same reaction can be used for quantitative analysis of cysteine-containing peptides, but then the modification is 16 Da less in mass; i.e. isotopically labeled reagent adds 126 Da in mass. synonym: "Was DTT_ST:2H(6)" [] xref: record_id "763" xref: delta_mono_mass "142.039317" xref: delta_avge_mass "142.2727" xref: delta_composition "H(2) 2H(6) C(4) O S(2)" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2007-07-10 20:34:46" xref: date_time_modified "2017-06-15 14:01:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:764 name: BEMAD_C:2H(6) def: "Beta elimination of alkylated Cys followed by Michael addition of labelled DTT." [PMID:15648052, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=764] comment: Can be used for quantitative analysis of cysteine-containing peptides. Same reaction can be used for quantitative analysis of O-linked post-translational modifications to serines and threonines, but then the modification is 16 Da more in mass; i.e. isotopically labeled reagent adds 142 Da in mass. synonym: "Was DTT_C:2H(6) Isotopically labeled Dithiothreitol (DTT) modification of cysteines" [] xref: record_id "764" xref: delta_mono_mass "126.062161" xref: delta_avge_mass "126.2071" xref: delta_composition "H(2) 2H(6) C(4) O(2) S" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2007-07-10 20:44:56" xref: date_time_modified "2017-06-15 13:59:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:765 name: Met-loss def: "Removal of initiator methionine from protein N-terminus." [PMID:3327521, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=765] comment: N-terminal initiator methionine is removed by a methionine aminopeptidase from proteins where the residue following the methionine is Ala, Cys, Gly, Pro, Ser, Thr or Val. This is generally the final N-terminal state for proteins where the following residue was a Cys, Pro or Val. xref: record_id "765" xref: delta_mono_mass "-131.040485" xref: delta_avge_mass "-131.1961" xref: delta_composition "H(-9) C(-5) N(-1) O(-1) S(-1)" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2007-07-10 22:40:00" xref: date_time_modified "2007-07-15 20:01:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Co-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:766 name: Met-loss+Acetyl def: "Removal of initiator methionine from protein N-terminus, then acetylation of the new N-terminus." [PMID:3327521, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=766] comment: The N-terminal initiator methionine is removed by a methionine aminopeptidase from proteins whose residue following the methionine is Ala, Cys, Gly, Pro, Ser, Thr or Val. Proteins whose following residue was Ala, Gly, Ser or Thr are then acetylated by an N(alpha)-acetyltransferase on the new N-terminus. xref: record_id "766" xref: delta_mono_mass "-89.02992" xref: delta_avge_mass "-89.1594" xref: delta_composition "H(-7) C(-3) N(-1) S(-1)" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2007-07-10 22:57:12" xref: date_time_modified "2007-07-15 20:01:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Protein N-term" xref: spec_1_classification "Co-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:767 name: Menadione-HQ def: "Menadione hydroquinone derivative." [PMID:15939799, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=767] xref: record_id "767" xref: delta_mono_mass "172.05243" xref: delta_avge_mass "172.18" xref: delta_composition "H(8) C(11) O(2)" xref: username_of_poster "catsriku" xref: group_of_poster "" xref: date_time_posted "2007-07-12 07:35:07" xref: date_time_modified "2007-07-15 20:05:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:768 name: Methyl+Acetyl:2H(3) def: "Mono-methylated lysine labelled with Acetyl_heavy." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=768] xref: record_id "768" xref: delta_mono_mass "59.045045" xref: delta_avge_mass "59.0817" xref: delta_composition "H 2H(3) C(3) O" xref: username_of_poster "buchanan" xref: group_of_poster "" xref: date_time_posted "2007-08-06 09:35:40" xref: date_time_modified "2007-09-07 16:56:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:771 name: lapachenole def: "Lapachenole photochemically added to cysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=771] xref: record_id "771" xref: delta_mono_mass "240.11503" xref: delta_avge_mass "240.297" xref: delta_composition "H(16) C(16) O(2)" xref: username_of_poster "hmfales" xref: group_of_poster "" xref: date_time_posted "2007-08-17 22:22:15" xref: date_time_modified "2007-09-07 16:52:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Simple cyclic compound C16H16O2 adds to cysteine forming fluorescent derivative." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:772 name: Label:13C(5) def: "13C(5) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=772] xref: record_id "772" xref: delta_mono_mass "5.016774" xref: delta_avge_mass "4.9633" xref: delta_composition "C(-5) 13C(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2007-08-22 18:36:11" xref: date_time_modified "2007-08-22 18:36:11" xref: approved "1" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Result of Arg to Pro conversion of 13C(6) labelled Arg" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:773 name: maleimide def: "Maleimide." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=773] xref: record_id "773" xref: delta_mono_mass "97.016378" xref: delta_avge_mass "97.0721" xref: delta_composition "H(3) C(4) N O(2)" xref: username_of_poster "mjayson" xref: group_of_poster "" xref: date_time_posted "2007-09-05 23:31:52" xref: date_time_modified "2007-09-06 11:28:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:774 name: Biotin-phenacyl def: "Alkylation by biotinylated form of phenacyl bromide." [PMID:428399, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=774] comment: Phenacyl bromide conjugated with a linker and biotin tag, details not published yet. xref: record_id "774" xref: delta_mono_mass "626.263502" xref: delta_avge_mass "626.727" xref: delta_composition "H(38) C(29) N(8) O(6) S" xref: username_of_poster "Sandeep" xref: group_of_poster "" xref: date_time_posted "2007-09-14 23:07:12" xref: date_time_modified "2007-10-03 15:42:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "S" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:775 name: Carboxymethyl:13C(2) def: "Iodoacetic acid derivative w/ 13C label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=775] synonym: "Carboxymethylation w/ 13C label" [] xref: record_id "775" xref: delta_mono_mass "60.012189" xref: delta_avge_mass "60.0214" xref: delta_composition "H(2) 13C(2) O(2)" xref: username_of_poster "mpcusack" xref: group_of_poster "" xref: date_time_posted "2007-09-18 19:26:42" xref: date_time_modified "2008-06-22 12:00:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:776 name: NEM:2H(5) def: "D5 N-ethylmaleimide on cysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=776] synonym: "CysNEM D5" [] xref: record_id "776" xref: delta_mono_mass "130.079062" xref: delta_avge_mass "130.1561" xref: delta_composition "H(2) 2H(5) C(6) N O(2)" xref: username_of_poster "mpcusack" xref: group_of_poster "" xref: date_time_posted "2007-09-18 19:49:39" xref: date_time_modified "2007-09-28 10:37:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:792 name: AEC-MAEC:2H(4) def: "Deuterium cysteamine modification to S or T." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=792] xref: record_id "792" xref: delta_mono_mass "63.044462" xref: delta_avge_mass "63.158" xref: delta_composition "H 2H(4) C(2) N O(-1) S" xref: username_of_poster "zwang23" xref: group_of_poster "" xref: date_time_posted "2007-10-03 19:41:19" xref: date_time_modified "2007-10-08 13:44:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:793 name: Hex(1)HexNAc(1) def: "Hex1HexNAc1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=793] xref: record_id "793" xref: delta_mono_mass "365.132196" xref: delta_avge_mass "365.3331" xref: delta_composition "Hex HexNAc" xref: username_of_poster "julienjardin" xref: group_of_poster "" xref: date_time_posted "2007-10-12 13:16:23" xref: date_time_modified "2017-11-23 13:04:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_366_mono_mass "365.132196" xref: spec_1_neutral_loss_366_avge_mass "365.3331" xref: spec_1_neutral_loss_366_flag "false" xref: spec_1_neutral_loss_366_composition "Hex HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_366_mono_mass "365.132196" xref: spec_1_neutral_loss_366_avge_mass "365.3331" xref: spec_1_neutral_loss_366_flag "false" xref: spec_1_neutral_loss_366_composition "Hex HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_misc_notes "Not reported for human proteins" xref: spec_2_neutral_loss_366_mono_mass "365.132196" xref: spec_2_neutral_loss_366_avge_mass "365.3331" xref: spec_2_neutral_loss_366_flag "false" xref: spec_2_neutral_loss_366_composition "Hex HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:799 name: Label:13C(6)+GG def: "13C6 labeled ubiquitinylation residue." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=799] comment: The two glycine residues left on SILAC labeled ubiquitinylated lysine after tryptic digestion. xref: record_id "799" xref: delta_mono_mass "120.063056" xref: delta_avge_mass "120.0586" xref: delta_composition "H(6) C(-2) 13C(6) N(2) O(2)" xref: username_of_poster "glick2" xref: group_of_poster "" xref: date_time_posted "2007-12-02 22:45:39" xref: date_time_modified "2014-07-09 16:53:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:800 name: Biotin:Thermo-21345 def: "Was PentylamineBiotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=01031206, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=800] synonym: "Used for labeling glutamine-donor substrate of transglutaminase" [] xref: record_id "800" xref: delta_mono_mass "311.166748" xref: delta_avge_mass "311.4429" xref: delta_composition "H(25) C(15) N(3) O(2) S" xref: username_of_poster "mengyi" xref: group_of_poster "" xref: date_time_posted "2007-12-03 13:56:58" xref: date_time_modified "2015-01-21 09:40:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:801 name: Pentylamine def: "Labeling transglutaminase substrate on glutamine side chain." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=801] xref: record_id "801" xref: delta_mono_mass "85.089149" xref: delta_avge_mass "85.1475" xref: delta_composition "H(11) C(5) N" xref: username_of_poster "mengyi" xref: group_of_poster "" xref: date_time_posted "2007-12-05 11:08:02" xref: date_time_modified "2007-12-14 17:52:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:811 name: Biotin:Thermo-21360 def: "Was Biotin-PEO4-hydrazide." [URL:http\://www.piercenet.com/products/browse.cfm?fldID=C4FE82D4-DD06-493C-8EC4-9C1D7F83211B, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=811] synonym: "Pierce EZ link biotin hydrazide prod no. 21360" [] xref: record_id "811" xref: delta_mono_mass "487.246455" xref: delta_avge_mass "487.6134" xref: delta_composition "H(37) C(21) N(5) O(6) S" xref: username_of_poster "MCole18" xref: group_of_poster "" xref: date_time_posted "2007-12-12 15:23:23" xref: date_time_modified "2010-12-03 16:05:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "hydrazide reacts at any activated carboxyl group" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:821 name: Cy3b-maleimide def: "Fluorescent dye that labels cysteines." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=821] synonym: "Cy3b meleimide reacted with Cysteine Formula requires confirmation" [] xref: record_id "821" xref: delta_mono_mass "682.24612" xref: delta_avge_mass "682.7852" xref: delta_composition "H(38) C(37) N(4) O(7) S" xref: username_of_poster "kfinan" xref: group_of_poster "" xref: date_time_posted "2008-02-01 16:03:09" xref: date_time_modified "2012-09-14 23:51:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:822 name: Gly-loss+Amide def: "Enzymatic glycine removal leaving an amidated C-terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=822] synonym: "Amidation requires presence of glycine at peptide terminus" [] xref: record_id "822" xref: delta_mono_mass "-58.005479" xref: delta_avge_mass "-58.0361" xref: delta_composition "H(-2) C(-2) O(-2)" xref: username_of_poster "timothyr" xref: group_of_poster "" xref: date_time_posted "2008-02-06 09:33:39" xref: date_time_modified "2010-07-14 23:15:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Any C-term" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:824 name: Xlink:BMOE def: "Intact or monolink BMOE crosslinker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011308_Bismaleimide_CrsLnk_BMOE_BMB_BMH_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=824] xref: record_id "824" xref: delta_mono_mass "220.048407" xref: delta_avge_mass "220.1815" xref: delta_composition "H(8) C(10) N(2) O(4)" xref: username_of_poster "Larsenmarsen" xref: group_of_poster "" xref: date_time_posted "2008-02-13 15:28:55" xref: date_time_modified "2017-08-18 11:12:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:825 name: Xlink:DFDNB def: "Intact DFDNB crosslinker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011313_DFDNB_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=825] xref: record_id "825" xref: delta_mono_mass "163.985807" xref: delta_avge_mass "164.0752" xref: delta_composition "C(6) N(2) O(4)" xref: username_of_poster "Larsenmarsen" xref: group_of_poster "" xref: date_time_posted "2008-02-13 15:35:40" xref: date_time_modified "2017-08-18 11:55:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Q" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:827 name: TMPP-Ac def: "Tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=827] comment: The formula has been reduced from H(34) to H(33) on 13 May 2009 so as to give correct observed m/z values. The charge on the TMPP means that ions have one less proton than would be expected. xref: record_id "827" xref: delta_mono_mass "572.181134" xref: delta_avge_mass "572.5401" xref: delta_composition "H(33) C(29) O(10) P" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2008-02-20 14:12:31" xref: date_time_modified "2018-06-26 15:22:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:830 name: Dihydroxyimidazolidine def: "Dihydroxy methylglyoxal adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=830] xref: record_id "830" xref: delta_mono_mass "72.021129" xref: delta_avge_mass "72.0627" xref: delta_composition "H(4) C(3) O(2)" xref: username_of_poster "kimzey" xref: group_of_poster "" xref: date_time_posted "2008-03-04 00:00:29" xref: date_time_modified "2008-05-22 00:32:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:834 name: Label:2H(4)+Acetyl def: "Acetyl 4,4,5,5-D4 Lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=834] comment: For SILAC experiments, + PTM. synonym: "Acetyl_K4" [] xref: record_id "834" xref: delta_mono_mass "46.035672" xref: delta_avge_mass "46.0613" xref: delta_composition "H(-2) 2H(4) C(2) O" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2008-03-24 17:25:15" xref: date_time_modified "2008-04-02 10:17:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Both isotopiclabel and post translational mod" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:835 name: Label:13C(6)+Acetyl def: "Acetyl 13C(6) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=835] xref: record_id "835" xref: delta_mono_mass "48.030694" xref: delta_avge_mass "47.9926" xref: delta_composition "H(2) C(-4) 13C(6) O" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2008-03-24 17:33:44" xref: date_time_modified "2008-04-02 10:14:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "SILAC and PTM" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:836 name: Label:13C(6)15N(2)+Acetyl def: "Acetyl_13C(6) 15N(2) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:12716131, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=836] synonym: "Acetyl_heavy lysine" [] xref: record_id "836" xref: delta_mono_mass "50.024764" xref: delta_avge_mass "49.9794" xref: delta_composition "H(2) C(-4) 13C(6) N(-2) 15N(2) O" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2008-03-24 17:35:52" xref: date_time_modified "2008-04-02 10:13:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:837 name: Arg->Npo def: "Arginine replacement by Nitropyrimidyl ornithine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=837] xref: record_id "837" xref: delta_mono_mass "80.985078" xref: delta_avge_mass "81.0297" xref: delta_composition "H(-1) C(3) N O(2)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2008-04-10 15:35:22" xref: date_time_modified "2008-04-21 18:30:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:846 name: EQIGG def: "Sumo mutant Smt3-WT tail following trypsin digestion." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=846] synonym: "Sumoylation" [] xref: record_id "846" xref: delta_mono_mass "484.228162" xref: delta_avge_mass "484.5035" xref: delta_composition "H(32) C(20) N(6) O(8)" xref: username_of_poster "Magnojunqueira" xref: group_of_poster "" xref: date_time_posted "2008-05-13 16:56:23" xref: date_time_modified "2008-05-17 18:58:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:848 name: Arg2PG def: "Adduct of phenylglyoxal with Arg." [PMID:11945751, PMID:11698400, PMID:5723461, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=848] xref: record_id "848" xref: delta_mono_mass "266.057909" xref: delta_avge_mass "266.2482" xref: delta_composition "H(10) C(16) O(4)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2008-05-16 11:07:51" xref: date_time_modified "2008-11-21 18:13:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "The reaction product of Arg with phenylglyoxal has been shown to be a 2:1 adduct" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:849 name: cGMP def: "S-guanylation." [PMID:17906641, PMID:15063129, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=849] comment: Protein which is posttranslationally modified by the attachment of cGMP on the sulfur atom of Cys or hydroxyl group of Ser residues. xref: record_id "849" xref: delta_mono_mass "343.031785" xref: delta_avge_mass "343.1895" xref: delta_composition "H(10) C(10) N(5) O(7) P" xref: username_of_poster "atsushiirie" xref: group_of_poster "" xref: date_time_posted "2008-06-21 09:02:53" xref: date_time_modified "2014-02-08 02:24:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:851 name: cGMP+RMP-loss def: "S-guanylation-2." [PMID:17906641, PMID:15063129, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=851] comment: Protein which is posttranslationally modified by the attachment of cGMP that has lost ribose 3\',5\'-cyclic monophosphate moiety on the sulfur atom of Cys or hydroxyl group of Ser. xref: record_id "851" xref: delta_mono_mass "150.041585" xref: delta_avge_mass "150.1182" xref: delta_composition "H(4) C(5) N(5) O" xref: username_of_poster "atsushiirie" xref: group_of_poster "" xref: date_time_posted "2008-06-21 09:06:56" xref: date_time_modified "2009-05-24 20:03:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:853 name: Label:2H(4)+GG def: "Ubiquitination 2H4 lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=853] xref: record_id "853" xref: delta_mono_mass "118.068034" xref: delta_avge_mass "118.1273" xref: delta_composition "H(2) 2H(4) C(4) N(2) O(2)" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2008-06-27 14:28:36" xref: date_time_modified "2014-07-09 16:52:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:859 name: MG-H1 def: "Methylglyoxal-derived hydroimidazolone." [PMID:15377717, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=859] xref: record_id "859" xref: delta_mono_mass "54.010565" xref: delta_avge_mass "54.0474" xref: delta_composition "H(2) C(3) O" xref: username_of_poster "AndrewW" xref: group_of_poster "" xref: date_time_posted "2008-07-24 14:41:07" xref: date_time_modified "2008-07-31 17:14:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:860 name: G-H1 def: "Glyoxal-derived hydroimiadazolone." [PMID:17143934, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=860] xref: record_id "860" xref: delta_mono_mass "39.994915" xref: delta_avge_mass "40.0208" xref: delta_composition "C(2) O" xref: username_of_poster "AndrewW" xref: group_of_poster "" xref: date_time_posted "2008-07-24 14:44:11" xref: date_time_modified "2008-07-31 17:16:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:861 name: ZGB def: "NHS ester linked Green Fluorescent Bodipy Dye." [URL:http\://www.zdye.com/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=861] xref: record_id "861" xref: delta_mono_mass "758.380841" xref: delta_avge_mass "758.7261" xref: delta_composition "H(53) B C(37) N(6) O(6) F(2) S" xref: username_of_poster "JBowden" xref: group_of_poster "" xref: date_time_posted "2008-07-30 14:51:06" xref: date_time_modified "2008-09-22 21:42:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:862 name: Label:13C(1)2H(3) def: "SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=862] xref: record_id "862" xref: delta_mono_mass "4.022185" xref: delta_avge_mass "4.0111" xref: delta_composition "H(-3) 2H(3) C(-1) 13C" xref: username_of_poster "msalek" xref: group_of_poster "" xref: date_time_posted "2008-08-11 13:43:25" xref: date_time_modified "2008-08-14 18:16:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Isotopic labeled methionine SILAC" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:864 name: Label:13C(6)15N(2)+GG def: "13C(6) 15N(2) Lysine glygly." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=864] synonym: "heavy glygly lysine" [] xref: record_id "864" xref: delta_mono_mass "122.057126" xref: delta_avge_mass "122.0454" xref: delta_composition "H(6) C(-2) 13C(6) 15N(2) O(2)" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2008-08-13 21:56:52" xref: date_time_modified "2014-07-09 16:53:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC PTM (glygly) experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:866 name: ICPL:13C(6)2H(4) def: "Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, +10 Da form." [URL:http\://www.bdal.de/life-science-tools/care-consumables-more/icpl-kit.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=866] comment: Attention: As the digest is typically applied AFTER ICPL labeling, only ProteinN-term labeling and Lys-specific labeling is applied. synonym: "ICPL_10" [] xref: record_id "866" xref: delta_mono_mass "115.0667" xref: delta_avge_mass "115.0747" xref: delta_composition "H(-1) 2H(4) 13C(6) N O" xref: username_of_poster "suckau" xref: group_of_poster "" xref: date_time_posted "2008-09-03 15:17:21" xref: date_time_modified "2008-09-12 11:59:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Isotopic label" xref: spec_2_misc_notes "Use when labelling pre-digest" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Use when labelling post-digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:876 name: QEQTGG def: "SUMOylation by SUMO-1." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=876] synonym: "GlnGluGlnThrGlyGly" [] xref: record_id "876" xref: delta_mono_mass "600.250354" xref: delta_avge_mass "600.5789" xref: delta_composition "H(36) C(23) N(8) O(11)" xref: username_of_poster "oosula" xref: group_of_poster "" xref: date_time_posted "2008-09-09 17:02:45" xref: date_time_modified "2011-11-25 13:05:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:877 name: QQQTGG def: "SUMOylation by SUMO-2/3." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=877] synonym: "GlnGlnGlnThrGlyGly" [] xref: record_id "877" xref: delta_mono_mass "599.266339" xref: delta_avge_mass "599.5942" xref: delta_composition "H(37) C(23) N(9) O(10)" xref: username_of_poster "oosula" xref: group_of_poster "" xref: date_time_posted "2008-09-09 17:09:04" xref: date_time_modified "2008-09-19 19:06:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:878 name: Bodipy def: "Bodipy modifications onto cysteine." [URL:http\://probes.invitrogen.com/handbook/sections/0104.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=878] synonym: "Which one?" [] xref: record_id "878" xref: delta_mono_mass "414.167478" xref: delta_avge_mass "414.2135" xref: delta_composition "H(21) B C(20) N(4) O(3) F(2)" xref: username_of_poster "anikolakakis" xref: group_of_poster "" xref: date_time_posted "2008-09-10 20:24:53" xref: date_time_modified "2008-09-12 18:30:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:884 name: Biotin:Thermo-21325 def: "Was ChromoBiotin." [URL:http\://www.piercenet.com/Products/Browse.cfm?fldID=44B1F9DF-B306-4278-B292-6CDB5B3B9D53, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=884] synonym: "EZ-Link NHS-Chromogenic Biotin" [] xref: record_id "884" xref: delta_mono_mass "695.310118" xref: delta_avge_mass "695.8288" xref: delta_composition "H(45) C(34) N(7) O(7) S" xref: username_of_poster "chens002" xref: group_of_poster "" xref: date_time_posted "2008-10-20 13:26:20" xref: date_time_modified "2010-12-03 16:04:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:885 name: Label:13C(1)2H(3)+Oxidation def: "Oxidised methionine 13C(1)2H(3) SILAC label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=885] xref: record_id "885" xref: delta_mono_mass "20.0171" xref: delta_avge_mass "20.0105" xref: delta_composition "H(-3) 2H(3) C(-1) 13C O" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2008-10-24 09:47:20" xref: date_time_modified "2009-09-25 13:15:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:886 name: HydroxymethylOP def: "2-ammonio-6-[4-(hydroxymethyl)-3-oxidopyridinium-1-yl]- hexanoate." [PMID:12595094, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=886] xref: record_id "886" xref: delta_mono_mass "108.021129" xref: delta_avge_mass "108.0948" xref: delta_composition "H(4) C(6) O(2)" xref: username_of_poster "AndrewW" xref: group_of_poster "" xref: date_time_posted "2008-11-03 14:35:36" xref: date_time_modified "2008-11-09 17:49:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "Advanced Glycation Endproduct" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:887 name: MDCC def: "Covalent linkage of maleimidyl coumarin probe (Molecular Probes D-10253)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=887] comment: MDCC is used extensively as a fluorescent probe to report changes in protein conformation. synonym: "CAS 156571-46-9 7-diethylamino-3-((((2-maleimidyl)ethyl)amino)carbonyl)coumarin" [] xref: record_id "887" xref: delta_mono_mass "383.148121" xref: delta_avge_mass "383.3978" xref: delta_composition "H(21) C(20) N(3) O(5)" xref: username_of_poster "shartson" xref: group_of_poster "" xref: date_time_posted "2008-12-03 16:20:46" xref: date_time_modified "2008-12-05 09:32:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Due to the mechanism of maleimidyl modification of Cys, the molecular weight of MDCC equals the mass shift created upon crossllinking (no chemical leaving group). During MS/MS, MDCC can reasonably be predicted to fragment readily and at various positions." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:888 name: mTRAQ def: "MTRAQ light." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=888] synonym: "Applied Biosystems mTRAQ(TM) reagent" [] xref: record_id "888" xref: delta_mono_mass "140.094963" xref: delta_avge_mass "140.183" xref: delta_composition "H(12) C(7) N(2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2008-12-04 13:50:02" xref: date_time_modified "2011-11-25 10:30:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Very low abundance" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "Very low abundance" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_6_misc_notes "Very low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:889 name: mTRAQ:13C(3)15N(1) def: "MTRAQ medium." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=889] synonym: "mTRAQ medium is identical to iTRAQ4plex 117 Applied Biosystems mTRAQ(TM) reagent" [] xref: record_id "889" xref: delta_mono_mass "144.102063" xref: delta_avge_mass "144.1544" xref: delta_composition "H(12) C(4) 13C(3) N 15N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2008-12-05 09:26:02" xref: date_time_modified "2011-11-25 10:34:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Very low abundance" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "Very low abundance" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_6_misc_notes "Very low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:890 name: DyLight-maleimide def: "Thiol-reactive dye for fluorescence labelling of proteins." [URL:http\://www.piercenet.com/files/1964as4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=890] xref: record_id "890" xref: delta_mono_mass "940.1999" xref: delta_avge_mass "941.0762" xref: delta_composition "H(48) C(39) N(4) O(15) S(4)" xref: username_of_poster "anikolakakis" xref: group_of_poster "" xref: date_time_posted "2008-12-05 15:23:15" xref: date_time_modified "2008-12-15 12:17:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:891 name: Methyl-PEO12-Maleimide def: "Methyl-PEO12-Maleimide." [URL:http\://www.piercenet.com/files/1768dh5.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=891] xref: record_id "891" xref: delta_mono_mass "710.383719" xref: delta_avge_mass "710.8073" xref: delta_composition "H(58) C(32) N(2) O(15)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2008-12-09 11:02:18" xref: date_time_modified "2008-12-15 12:15:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:893 name: CarbamidomethylDTT def: "Carbamidomethylated DTT modification of cysteine." [PMID:18653769, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=893] xref: record_id "893" xref: delta_mono_mass "209.018035" xref: delta_avge_mass "209.2864" xref: delta_composition "H(11) C(6) N O(3) S(2)" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2009-01-09 01:39:37" xref: date_time_modified "2017-06-15 14:11:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:894 name: CarboxymethylDTT def: "Carboxymethylated DTT modification of cysteine." [PMID:18653769, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=894] xref: record_id "894" xref: delta_mono_mass "210.00205" xref: delta_avge_mass "210.2712" xref: delta_composition "H(10) C(6) O(4) S(2)" xref: username_of_poster "chalkley" xref: group_of_poster "" xref: date_time_posted "2009-01-09 01:43:09" xref: date_time_modified "2009-01-10 19:03:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:895 name: Biotin-PEG-PRA def: "Biotin polyethyleneoxide (n=3) alkyne." [URL:http\://etd.caltech.edu/etd/available/etd-09132005-120123/unrestricted/Chapter2.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=895] comment: Methionine (C5H11NO2S) is substituted in cell culture by Azidohomoalanine (C4H8N4O2). The azido group reacts with an alkyne group attached to a linker (PEO) with a biotin group at the end (C27H45N5O7S). As a result the side chain of Met (C3H7S) is substitued by C29H49N8O7S. xref: record_id "895" xref: delta_mono_mass "578.317646" xref: delta_avge_mass "578.6611" xref: delta_composition "H(42) C(26) N(8) O(7)" xref: username_of_poster "Larsenmarsen" xref: group_of_poster "" xref: date_time_posted "2009-01-19 10:54:58" xref: date_time_modified "2009-02-06 16:50:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:896 name: Met->Aha def: "Methionine replacement by azido homoalanine." [PMID:16281315, PMID:11752401, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=896] xref: record_id "896" xref: delta_mono_mass "-4.986324" xref: delta_avge_mass "-5.0794" xref: delta_composition "H(-3) C(-1) N(3) S(-1)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2009-01-30 14:52:20" xref: date_time_modified "2009-02-06 16:38:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:897 name: Label:15N(4) def: "SILAC 15N(4)." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=897] synonym: "Metabolic labeling with ammonium sulfate (15N)" [] xref: record_id "897" xref: delta_mono_mass "3.98814" xref: delta_avge_mass "3.9736" xref: delta_composition "N(-4) 15N(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2009-02-06 15:29:55" xref: date_time_modified "2011-11-21 14:26:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:898 name: pyrophospho def: "Pyrophosphorylation of Ser/Thr." [PMID:17873058, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=898] xref: record_id "898" xref: delta_mono_mass "159.932662" xref: delta_avge_mass "159.9598" xref: delta_composition "H(2) O(6) P(2)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2009-02-23 20:54:00" xref: date_time_modified "2009-11-11 09:39:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_neutral_loss_177_mono_mass "176.935402" xref: spec_1_neutral_loss_177_avge_mass "176.9671" xref: spec_1_neutral_loss_177_flag "false" xref: spec_1_neutral_loss_177_composition "H(3) O(7) P(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_2_neutral_loss_177_mono_mass "176.935402" xref: spec_2_neutral_loss_177_avge_mass "176.9671" xref: spec_2_neutral_loss_177_flag "false" xref: spec_2_neutral_loss_177_composition "H(3) O(7) P(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:899 name: Met->Hpg def: "Methionine replacement by homopropargylglycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=899] xref: record_id "899" xref: delta_mono_mass "-21.987721" xref: delta_avge_mass "-22.0702" xref: delta_composition "H(-2) C S(-1)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2009-02-24 17:11:44" xref: date_time_modified "2009-03-13 16:00:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:901 name: 4AcAllylGal def: "2,3,4,6-tetra-O-Acetyl-1-allyl-alpha-D-galactopyranoside modification of cysteine." [PMID:18275052, PMID:19798718, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=901] xref: record_id "901" xref: delta_mono_mass "372.142033" xref: delta_avge_mass "372.3671" xref: delta_composition "H(24) C(17) O(9)" xref: username_of_poster "paolo.nanni" xref: group_of_poster "" xref: date_time_posted "2009-03-06 16:08:43" xref: date_time_modified "2014-06-23 14:32:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:902 name: DimethylArsino def: "Reaction with dimethylarsinous (AsIII) acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=902] comment: Protein from animals exposed to organoarsenicals. xref: record_id "902" xref: delta_mono_mass "103.960719" xref: delta_avge_mass "103.9827" xref: delta_composition "H(5) C(2) As" xref: username_of_poster "dashford" xref: group_of_poster "" xref: date_time_posted "2009-03-09 17:03:27" xref: date_time_modified "2009-03-13 15:59:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:903 name: Lys->CamCys def: "Lys->Cys substitution and carbamidomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=903] comment: For Brad Strader. xref: record_id "903" xref: delta_mono_mass "31.935685" xref: delta_avge_mass "32.0219" xref: delta_composition "H(-4) C(-1) O S" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2009-04-17 14:47:30" xref: date_time_modified "2009-05-01 16:47:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Pre-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:904 name: Phe->CamCys def: "Phe->Cys substitution and carbamidomethylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=904] comment: For Brad Strader. xref: record_id "904" xref: delta_mono_mass "12.962234" xref: delta_avge_mass "13.0204" xref: delta_composition "H(-1) C(-4) N O S" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2009-04-17 14:49:02" xref: date_time_modified "2009-07-13 18:16:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "Pre-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:905 name: Leu->MetOx def: "Leu->Met substitution and sulfoxidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=905] comment: For Brad Strader. xref: record_id "905" xref: delta_mono_mass "33.951335" xref: delta_avge_mass "34.0378" xref: delta_composition "H(-2) C(-1) O S" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2009-04-17 14:50:35" xref: date_time_modified "2009-05-01 16:47:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "Pre-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:906 name: Lys->MetOx def: "Lys->Met substitution and sulfoxidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=906] comment: For Brad Strader. xref: record_id "906" xref: delta_mono_mass "18.940436" xref: delta_avge_mass "19.0232" xref: delta_composition "H(-3) C(-1) N(-1) O S" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2009-04-17 14:51:35" xref: date_time_modified "2009-05-01 16:46:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Pre-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:907 name: Galactosyl def: "Gluconoylation." [URL:http\://www.abrf.org/index.cfm/dm.details?DMID=226&AvgMass=all&Margin=0, PMID:743239, PMID:18083862, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=907] xref: record_id "907" xref: delta_mono_mass "178.047738" xref: delta_avge_mass "178.14" xref: delta_composition "O Hex" xref: username_of_poster "zientek" xref: group_of_poster "" xref: date_time_posted "2009-04-21 18:11:24" xref: date_time_modified "2015-05-07 11:02:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Other glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:908 name: Xlink:SMCC[321] def: "Monolink of SMCC terminated with 3-(dimethylamino)-1-propylamine." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011295_SMCC_SulfoSMCC_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=908] xref: record_id "908" xref: delta_mono_mass "321.205242" xref: delta_avge_mass "321.4146" xref: delta_composition "H(27) C(17) N(3) O(3)" xref: username_of_poster "anikolakakis" xref: group_of_poster "" xref: date_time_posted "2009-04-23 19:39:42" xref: date_time_modified "2017-09-01 14:46:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:910 name: Bacillosamine def: "2,4-diacetamido-2,4,6-trideoxyglucopyranose." [PMID:12186869, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=910] synonym: "Asn-linked glycan from Gram-negative Bacterium DATDH" [] xref: record_id "910" xref: delta_mono_mass "228.111007" xref: delta_avge_mass "228.245" xref: delta_composition "H(6) C(4) N(2) dHex" xref: username_of_poster "rlmoritz" xref: group_of_poster "" xref: date_time_posted "2009-06-23 18:27:32" xref: date_time_modified "2017-11-29 14:04:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_229_mono_mass "228.111007" xref: spec_1_neutral_loss_229_avge_mass "228.245" xref: spec_1_neutral_loss_229_flag "false" xref: spec_1_neutral_loss_229_composition "H(6) C(4) N(2) dHex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:911 name: MTSL def: "Cys modification by (1-oxyl-2,2,5,5-tetramethyl-3-pyrroline-3-methyl)methanesulfonate (MTSL)." [PMID:9335564, PMID:12441112, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=911] xref: record_id "911" xref: delta_mono_mass "184.07961" xref: delta_avge_mass "184.2786" xref: delta_composition "H(14) C(9) N O S" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2009-06-25 20:19:40" xref: date_time_modified "2009-06-26 11:13:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:912 name: HNE-BAHAH def: "4-hydroxy-2-nonenal and biotinamidohexanoic acid hydrazide, reduced." [PMID:19054759, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=912] comment: For Bindu Abraham. xref: record_id "912" xref: delta_mono_mass "511.319226" xref: delta_avge_mass "511.7209" xref: delta_composition "H(45) C(25) N(5) O(4) S" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2009-07-13 18:23:28" xref: date_time_modified "2009-07-17 17:49:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:914 name: Methylmalonylation def: "Methylmalonylation on Serine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=914] comment: Structural isomer to succinyl. xref: record_id "914" xref: delta_mono_mass "100.016044" xref: delta_avge_mass "100.0728" xref: delta_composition "H(4) C(4) O(3)" xref: username_of_poster "xwei" xref: group_of_poster "" xref: date_time_posted "2009-07-15 23:43:13" xref: date_time_modified "2010-11-24 17:59:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:923 name: Label:13C(4)15N(2)+GG def: "13C(4) 15N(2) Lysine glygly." [PMID:12716131, URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=923] synonym: "heavy glygly lysine" [] xref: record_id "923" xref: delta_mono_mass "120.050417" xref: delta_avge_mass "120.0601" xref: delta_composition "H(6) 13C(4) 15N(2) O(2)" xref: username_of_poster "mpcusack" xref: group_of_poster "" xref: date_time_posted "2009-09-16 21:04:07" xref: date_time_modified "2014-07-09 16:53:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "Used in SILAC PTM (glygly) experiment" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:926 name: ethylamino def: "Ethyl amino." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=926] comment: Product of beta elimination of phospho- or glycosylated-Ser with addition of ethylamine. xref: record_id "926" xref: delta_mono_mass "27.047285" xref: delta_avge_mass "27.0684" xref: delta_composition "H(5) C(2) N O(-1)" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2009-09-17 20:37:18" xref: date_time_modified "2009-10-02 18:21:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:928 name: MercaptoEthanol def: "2-OH-ethyl thio-Ser." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=928] comment: Product of beta elimination of phospho- or glycosylated-Ser with addition of beta Mercapto Ethanol. xref: record_id "928" xref: delta_mono_mass "60.003371" xref: delta_avge_mass "60.1182" xref: delta_composition "H(4) C(2) S" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2009-09-17 20:43:13" xref: date_time_modified "2009-10-02 18:23:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:931 name: Ethyl+Deamidated def: "Deamidation followed by esterification with ethanol." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=931] xref: record_id "931" xref: delta_mono_mass "29.015316" xref: delta_avge_mass "29.0379" xref: delta_composition "H(3) C(2) N(-1) O" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2009-09-22 11:05:21" xref: date_time_modified "2012-08-06 14:58:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Q" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:932 name: VFQQQTGG def: "SUMOylation by SUMO-2/3 (formic acid cleavage)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=932] synonym: "ValPheGlnGlnGlnThrGlyGly" [] xref: record_id "932" xref: delta_mono_mass "845.403166" xref: delta_avge_mass "845.8991" xref: delta_composition "H(55) C(37) N(11) O(12)" xref: username_of_poster "oosula" xref: group_of_poster "" xref: date_time_posted "2009-09-24 16:11:11" xref: date_time_modified "2010-02-02 18:25:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "This peptide is generated from a formic acid digest" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:933 name: VIEVYQEQTGG def: "SUMOylation by SUMO-1 (formic acid cleavage)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=933] synonym: "ValIleGluValTyrGlnGluGlnThrGlyGly" [] xref: record_id "933" xref: delta_mono_mass "1203.577168" xref: delta_avge_mass "1204.2859" xref: delta_composition "H(81) C(53) N(13) O(19)" xref: username_of_poster "oosula" xref: group_of_poster "" xref: date_time_posted "2009-09-24 16:15:34" xref: date_time_modified "2009-10-02 18:31:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:934 name: AMTzHexNAc2 def: "Photocleavable Biotin + GalNAz on O-GlcNAc." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=934] xref: record_id "934" xref: delta_mono_mass "502.202341" xref: delta_avge_mass "502.4757" xref: delta_composition "H(30) C(19) N(6) O(10)" xref: username_of_poster "mskim" xref: group_of_poster "" xref: date_time_posted "2009-10-08 18:05:00" xref: date_time_modified "2010-10-03 13:45:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:935 name: Atto495Maleimide def: "High molecular absorption maleimide label for proteins." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=935] xref: record_id "935" xref: delta_mono_mass "474.250515" xref: delta_avge_mass "474.5747" xref: delta_composition "H(32) C(27) N(5) O(3)" xref: username_of_poster "anikolakakis" xref: group_of_poster "" xref: date_time_posted "2009-10-14 18:48:56" xref: date_time_modified "2009-10-16 14:34:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:936 name: Chlorination def: "Chlorination of tyrosine residues." [PMID:14660678, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=936] xref: record_id "936" xref: delta_mono_mass "33.961028" xref: delta_avge_mass "34.4451" xref: delta_composition "H(-1) Cl" xref: username_of_poster "Bryan" xref: group_of_poster "" xref: date_time_posted "2009-10-15 17:07:41" xref: date_time_modified "2017-11-08 16:03:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:937 name: dichlorination def: "Dichlorination." [PMID:11733505, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=937] xref: record_id "937" xref: delta_mono_mass "67.922055" xref: delta_avge_mass "68.8901" xref: delta_composition "H(-2) Cl(2)" xref: username_of_poster "Bryan" xref: group_of_poster "" xref: date_time_posted "2009-10-15 17:12:42" xref: date_time_modified "2014-05-19 10:13:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:938 name: AROD def: "Cysteine modifier." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=938] comment: The electrophilic moiety of the chemical forms a direct bond with the thiol bond of the cysteine. As a result, there are no losses of elements and the final adduct has the monoisotopic mass of the chemical at 820.3360 added to a cysteine at SH side chain. xref: record_id "938" xref: delta_mono_mass "820.336015" xref: delta_avge_mass "820.979" xref: delta_composition "H(52) C(35) N(10) O(9) S(2)" xref: username_of_poster "hbromage" xref: group_of_poster "" xref: date_time_posted "2009-10-15 19:27:20" xref: date_time_modified "2009-10-16 14:41:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:939 name: Cys->methylaminoAla def: "Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of methylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=939] xref: record_id "939" xref: delta_mono_mass "-2.945522" xref: delta_avge_mass "-3.0238" xref: delta_composition "H(3) C N S(-1)" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2009-10-16 13:50:33" xref: date_time_modified "2009-10-16 14:44:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:940 name: Cys->ethylaminoAla def: "Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of ethylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=940] xref: record_id "940" xref: delta_mono_mass "11.070128" xref: delta_avge_mass "11.0028" xref: delta_composition "H(5) C(2) N S(-1)" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2009-10-16 13:53:46" xref: date_time_modified "2009-10-16 14:44:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:941 name: DNPS def: "2,4-Dinitrobenzenesulfenyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=941] synonym: "Trp modification with 2,4-Dinitrobenzenesulfenyl" [] xref: record_id "941" xref: delta_mono_mass "198.981352" xref: delta_avge_mass "199.164" xref: delta_composition "H(3) C(6) N(2) O(4) S" xref: username_of_poster "odra.pinato" xref: group_of_poster "" xref: date_time_posted "2009-10-19 13:08:56" xref: date_time_modified "2009-10-30 18:23:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Fontana A. Biochemistry. vol 7. 980-986 (1968)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "derivatization of Trp residues using the 2,4-dinitrophenyl-sulfenyl chloride (DNPS-Cl) reagent, that leads to a Trp derivative with the DNPS label attached at 2-position of the indole nucleus." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:942 name: SulfoGMBS def: "High molecular absorption label for proteins." [URL:http\://www.piercenet.com/files/1763dh4.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=942] xref: record_id "942" xref: delta_mono_mass "458.162391" xref: delta_avge_mass "458.5306" xref: delta_composition "H(26) C(22) N(4) O(5) S" xref: username_of_poster "anikolakakis" xref: group_of_poster "" xref: date_time_posted "2009-10-26 19:28:04" xref: date_time_modified "2009-11-13 17:02:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:943 name: DimethylamineGMBS def: "Modified GMBS X linker." [URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011551_GMBS_SulfoGMBS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=943] xref: record_id "943" xref: delta_mono_mass "267.158292" xref: delta_avge_mass "267.3241" xref: delta_composition "H(21) C(13) N(3) O(3)" xref: username_of_poster "anikolakakis" xref: group_of_poster "" xref: date_time_posted "2009-11-04 20:26:57" xref: date_time_modified "2017-01-18 11:52:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:944 name: Label:15N(2)2H(9) def: "SILAC label." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=944] synonym: "Label:15N(2)2H(9)" [] xref: record_id "944" xref: delta_mono_mass "11.050561" xref: delta_avge_mass "11.0423" xref: delta_composition "H(-9) 2H(9) N(-2) 15N(2)" xref: username_of_poster "mskim" xref: group_of_poster "" xref: date_time_posted "2009-11-25 22:32:49" xref: date_time_modified "2009-12-07 20:03:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:946 name: LG-anhydrolactam def: "Levuglandinyl-lysine anhydrolactam adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=946] xref: record_id "946" xref: delta_mono_mass "314.188195" xref: delta_avge_mass "314.4186" xref: delta_composition "H(26) C(20) O(3)" xref: username_of_poster "wridenour" xref: group_of_poster "" xref: date_time_posted "2010-01-12 01:08:28" xref: date_time_modified "2011-06-08 18:01:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:947 name: LG-pyrrole def: "Levuglandinyl-lysine pyrrole adduct." [PMID:10413514, URL:http\://www.hmdb.ca/metabolites/HMDB0005079, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=947] xref: record_id "947" xref: delta_mono_mass "316.203845" xref: delta_avge_mass "316.4345" xref: delta_composition "H(28) C(20) O(3)" xref: username_of_poster "wridenour" xref: group_of_poster "" xref: date_time_posted "2010-01-12 01:12:38" xref: date_time_modified "2020-01-21 14:42:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "C" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" xref: spec_3_misc_notes "15-deoxy-PGJ2 (15d-PGJ2) influences multiple signaling pathways by covalently binding with key signaling molecules" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:948 name: LG-anhyropyrrole def: "Levuglandinyl-lysine anhyropyrrole adduct." [PMID:10413514, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=948] xref: record_id "948" xref: delta_mono_mass "298.19328" xref: delta_avge_mass "298.4192" xref: delta_composition "H(26) C(20) O(2)" xref: username_of_poster "wridenour" xref: group_of_poster "" xref: date_time_posted "2010-01-12 01:14:46" xref: date_time_modified "2011-06-08 17:59:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:949 name: 3-deoxyglucosone def: "Condensation product of 3-deoxyglucosone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=949] xref: record_id "949" xref: delta_mono_mass "144.042259" xref: delta_avge_mass "144.1253" xref: delta_composition "H(8) C(6) O(4)" xref: username_of_poster "kimzey" xref: group_of_poster "" xref: date_time_posted "2010-01-15 18:19:17" xref: date_time_modified "2010-01-18 13:20:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:950 name: Cation:Li def: "Replacement of proton by lithium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=950] xref: record_id "950" xref: delta_mono_mass "6.008178" xref: delta_avge_mass "5.9331" xref: delta_composition "H(-1) Li" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:17:12" xref: date_time_modified "2010-01-20 12:17:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:951 name: Cation:Ca[II] def: "Replacement of 2 protons by calcium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=951] xref: record_id "951" xref: delta_mono_mass "37.946941" xref: delta_avge_mass "38.0621" xref: delta_composition "H(-2) Ca" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:20:03" xref: date_time_modified "2010-01-20 12:36:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:952 name: Cation:Fe[II] def: "Replacement of 2 protons by iron." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=952] xref: record_id "952" xref: delta_mono_mass "53.919289" xref: delta_avge_mass "53.8291" xref: delta_composition "H(-2) Fe" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:21:03" xref: date_time_modified "2010-01-20 12:21:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:953 name: Cation:Ni[II] def: "Replacement of 2 protons by nickel." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=953] xref: record_id "953" xref: delta_mono_mass "55.919696" xref: delta_avge_mass "56.6775" xref: delta_composition "H(-2) Ni" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:22:52" xref: date_time_modified "2010-01-20 12:22:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:954 name: Cation:Zn[II] def: "Replacement of 2 protons by zinc." [URL:http\://www.uniprot.org/uniprot/P07509, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=954] xref: record_id "954" xref: delta_mono_mass "61.913495" xref: delta_avge_mass "63.3931" xref: delta_composition "H(-2) Zn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:23:59" xref: date_time_modified "2015-03-19 09:31:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "H" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:955 name: Cation:Ag def: "Replacement of proton by silver." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=955] xref: record_id "955" xref: delta_mono_mass "105.897267" xref: delta_avge_mass "106.8603" xref: delta_composition "H(-1) Ag" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:30:59" xref: date_time_modified "2010-01-20 12:30:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:956 name: Cation:Mg[II] def: "Replacement of 2 protons by magnesium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=956] xref: record_id "956" xref: delta_mono_mass "21.969392" xref: delta_avge_mass "22.2891" xref: delta_composition "H(-2) Mg" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-01-20 12:36:18" xref: date_time_modified "2010-01-20 12:36:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:957 name: 2-succinyl def: "S-(2-succinyl) cysteine." [PMID:18448829, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=957] xref: record_id "957" xref: delta_mono_mass "116.010959" xref: delta_avge_mass "116.0722" xref: delta_composition "H(4) C(4) O(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-01-26 09:57:53" xref: date_time_modified "2010-10-15 15:51:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:958 name: Propargylamine def: "Propargylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=958] xref: record_id "958" xref: delta_mono_mass "37.031634" xref: delta_avge_mass "37.0632" xref: delta_composition "H(3) C(3) N O(-1)" xref: username_of_poster "ywswansea" xref: group_of_poster "" xref: date_time_posted "2010-01-26 14:37:33" xref: date_time_modified "2010-02-01 09:26:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:959 name: Phosphopropargyl def: "Phospho-propargylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=959] xref: record_id "959" xref: delta_mono_mass "116.997965" xref: delta_avge_mass "117.0431" xref: delta_composition "H(4) C(3) N O(2) P" xref: username_of_poster "ywswansea" xref: group_of_poster "" xref: date_time_posted "2010-01-26 14:42:08" xref: date_time_modified "2010-02-01 09:25:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Multiple" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:960 name: SUMO2135 def: "SUMOylation by SUMO-1 after tryptic cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=960] synonym: "ELGMEEEDVIEVYQEQTGG" [] xref: record_id "960" xref: delta_mono_mass "2135.920496" xref: delta_avge_mass "2137.2343" xref: delta_composition "H(137) C(90) N(21) O(37) S" xref: username_of_poster "oosula" xref: group_of_poster "" xref: date_time_posted "2010-02-02 18:17:15" xref: date_time_modified "2010-02-14 11:28:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:961 name: SUMO3549 def: "SUMOylation by SUMO-2/3 after tryptic cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=961] synonym: "FDGQPINETDTPAQLEMEDEDTIDVFQQQTGG" [] xref: record_id "961" xref: delta_mono_mass "3549.536568" xref: delta_avge_mass "3551.6672" xref: delta_composition "H(224) C(150) N(38) O(60) S" xref: username_of_poster "oosula" xref: group_of_poster "" xref: date_time_posted "2010-02-02 18:21:23" xref: date_time_modified "2010-02-14 11:27:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:967 name: thioacylPA def: "Membrane protein extraction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=967] xref: record_id "967" xref: delta_mono_mass "159.035399" xref: delta_avge_mass "159.2062" xref: delta_composition "H(9) C(6) N O(2) S" xref: username_of_poster "tmiwamoto" xref: group_of_poster "" xref: date_time_posted "2010-02-05 06:00:39" xref: date_time_modified "2010-04-05 21:31:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:971 name: maleimide3 def: "Maleimide-3-saccharide." [PMID:18925771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=971] comment: Created for Bindu Abraham 12/22/09. xref: record_id "971" xref: delta_mono_mass "969.366232" xref: delta_avge_mass "969.8975" xref: delta_composition "H(59) C(37) N(7) O(23)" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2010-02-12 17:23:33" xref: date_time_modified "2010-04-05 21:30:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:972 name: maleimide5 def: "Maleimide-5-saccharide." [PMID:18925771, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=972] comment: Created for Bindu Abraham 12/22/09. xref: record_id "972" xref: delta_mono_mass "1293.471879" xref: delta_avge_mass "1294.1787" xref: delta_composition "H(79) C(49) N(7) O(33)" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2010-02-12 17:25:52" xref: date_time_modified "2010-04-05 21:29:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:973 name: Puromycin def: "Puromycin." [PMID:10666460, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=973] comment: Created for Michael (Brad) Strader 2/12/10. xref: record_id "973" xref: delta_mono_mass "453.212452" xref: delta_avge_mass "453.4943" xref: delta_composition "H(27) C(22) N(7) O(4)" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2010-02-12 20:50:31" xref: date_time_modified "2010-04-12 15:38:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Co-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:977 name: Carbofuran def: "2,3-dihydro-2,2-dimethyl-7-benzofuranol N-methyl carbamate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=977] xref: record_id "977" xref: delta_mono_mass "58.029289" xref: delta_avge_mass "58.0593" xref: delta_composition "H(4) C(2) N O" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2010-02-24 21:10:32" xref: date_time_modified "2010-04-05 21:27:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:978 name: BITC def: "Benzyl isothiocyanate." [PMID:22835833, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=978] xref: record_id "978" xref: delta_mono_mass "149.02992" xref: delta_avge_mass "149.2129" xref: delta_composition "H(7) C(8) N S" xref: username_of_poster "miyoshin" xref: group_of_poster "" xref: date_time_posted "2010-03-09 09:42:12" xref: date_time_modified "2013-04-26 06:26:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:979 name: PEITC def: "Phenethyl isothiocyanate." [PMID:22835833, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=979] xref: record_id "979" xref: delta_mono_mass "163.04557" xref: delta_avge_mass "163.2395" xref: delta_composition "H(9) C(9) N S" xref: username_of_poster "miyoshin" xref: group_of_poster "" xref: date_time_posted "2010-03-09 10:06:18" xref: date_time_modified "2013-04-26 06:27:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:981 name: glucosone def: "Condensation product of glucosone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=981] xref: record_id "981" xref: delta_mono_mass "160.037173" xref: delta_avge_mass "160.1247" xref: delta_composition "H(8) C(6) O(5)" xref: username_of_poster "kimzey" xref: group_of_poster "" xref: date_time_posted "2010-03-31 00:28:53" xref: date_time_modified "2010-04-05 21:25:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:984 name: cysTMT def: "Native cysteine-reactive Tandem Mass Tag®." [URL:http\://bit.ly/1GBnaC8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=984] comment: This modification describes the native cysteine-reactive cysTMT Reagent without isotopic label. Upon CID, this reagent releases a reporter ion of 126.127725 (monoisotopic mass). synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] xref: record_id "984" xref: delta_mono_mass "299.166748" xref: delta_avge_mass "299.4322" xref: delta_composition "H(25) C(14) N(3) O(2) S" xref: username_of_poster "jorogers6" xref: group_of_poster "" xref: date_time_posted "2010-04-22 21:57:44" xref: date_time_modified "2014-11-08 16:06:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:985 name: cysTMT6plex def: "Cysteine-reactive Sixplex Tandem Mass Tag®." [URL:http\://bit.ly/1GBnaC8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=985] comment: This modification describes the isobaric sixplex cysteine-reactive cysTMT6 Reagents with isotopic labels. Upon CID, these reagents release reporter ions of 126.127725, 127.131079, 128.134433, 129.137787, 130.141141, and 131.138176 (monoisotopic mass). synonym: "Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] xref: record_id "985" xref: delta_mono_mass "304.177202" xref: delta_avge_mass "304.3962" xref: delta_composition "H(25) C(10) 13C(4) N(2) 15N O(2) S" xref: username_of_poster "jorogers6" xref: group_of_poster "" xref: date_time_posted "2010-04-22 22:05:46" xref: date_time_modified "2016-09-22 14:38:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:986 name: Label:13C(6)+Dimethyl def: "Dimethyl 13C(6) Silac label." [FindMod:DIMETH, URL:http\://www.pil.sdu.dk/silac_intro.htm, PMID:http://www.ncbi.nlm.nih.gov/pubmed/14670044?dopt=AbstractPlus, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=986] xref: record_id "986" xref: delta_mono_mass "34.051429" xref: delta_avge_mass "34.0091" xref: delta_composition "H(4) C(-4) 13C(6)" xref: username_of_poster "glick2" xref: group_of_poster "" xref: date_time_posted "2010-05-09 10:48:19" xref: date_time_modified "2010-05-14 16:19:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "SILAC+PTM" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:987 name: Label:13C(6)15N(2)+Dimethyl def: "Dimethyl 13C(6)15N(2) Silac label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, FindMod:DIMETH, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=987] xref: record_id "987" xref: delta_mono_mass "36.045499" xref: delta_avge_mass "35.9959" xref: delta_composition "H(4) C(-4) 13C(6) N(-2) 15N(2)" xref: username_of_poster "glick2" xref: group_of_poster "" xref: date_time_posted "2010-05-09 10:57:55" xref: date_time_modified "2010-05-14 16:20:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_1_misc_notes "SILAC+PTM" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:989 name: Ammonium def: "Replacement of proton with ammonium ion." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=989] comment: Sometimes observed after elution of phosphopeptides from TiO2 with ammonium hydroxide. xref: record_id "989" xref: delta_mono_mass "17.026549" xref: delta_avge_mass "17.0305" xref: delta_composition "H(3) N" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-05-18 10:32:03" xref: date_time_modified "2010-06-04 15:08:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:991 name: ISD_z+2_ion def: "ISD (z+2)-series." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=991] xref: record_id "991" xref: delta_mono_mass "-15.010899" xref: delta_avge_mass "-15.0146" xref: delta_composition "H(-1) N(-1)" xref: username_of_poster "suckau" xref: group_of_poster "" xref: date_time_posted "2010-06-08 09:42:52" xref: date_time_modified "2010-06-28 10:47:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "this is a "virtual modification", as it only accounts for the structure of the MS/MS fragment as it occurs in Top-Down MS/MS analyses. This must be accounted for in MS³-analysis of z+2 ions" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:993 name: Biotin:Sigma-B1267 def: "Was Biotin-maleimide." [PMID:15449375, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=993] synonym: "maleimide biotinylated" [] xref: record_id "993" xref: delta_mono_mass "449.17329" xref: delta_avge_mass "449.5239" xref: delta_composition "H(27) C(20) N(5) O(5) S" xref: username_of_poster "mpcusack" xref: group_of_poster "" xref: date_time_posted "2010-06-10 07:50:00" xref: date_time_modified "2010-12-03 16:02:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:994 name: Label:15N(1) def: "15N(1)." [PMID:19664813, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=994] synonym: "Metabolic labeling with ammonium sulfate (15N)" [] xref: record_id "994" xref: delta_mono_mass "0.997035" xref: delta_avge_mass "0.9934" xref: delta_composition "N(-1) 15N" xref: username_of_poster "ppicotti" xref: group_of_poster "" xref: date_time_posted "2010-06-22 14:52:08" xref: date_time_modified "2011-11-21 14:26:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "G" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "A" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "P" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "V" xref: spec_7_position "Anywhere" xref: spec_7_classification "Isotopic label" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "T" xref: spec_8_position "Anywhere" xref: spec_8_classification "Isotopic label" xref: spec_9_group "9" xref: spec_9_hidden "1" xref: spec_9_site "C" xref: spec_9_position "Anywhere" xref: spec_9_classification "Isotopic label" xref: spec_10_group "10" xref: spec_10_hidden "1" xref: spec_10_site "I" xref: spec_10_position "Anywhere" xref: spec_10_classification "Isotopic label" xref: spec_11_group "11" xref: spec_11_hidden "1" xref: spec_11_site "L" xref: spec_11_position "Anywhere" xref: spec_11_classification "Isotopic label" xref: spec_12_group "12" xref: spec_12_hidden "1" xref: spec_12_site "D" xref: spec_12_position "Anywhere" xref: spec_12_classification "Isotopic label" xref: spec_13_group "13" xref: spec_13_hidden "1" xref: spec_13_site "E" xref: spec_13_position "Anywhere" xref: spec_13_classification "Isotopic label" xref: spec_14_group "14" xref: spec_14_hidden "1" xref: spec_14_site "M" xref: spec_14_position "Anywhere" xref: spec_14_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:995 name: Label:15N(2) def: "15N(2)." [PMID:19664813, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=995] synonym: "Metabolic labeling with ammonium sulfate (15N)" [] xref: record_id "995" xref: delta_mono_mass "1.99407" xref: delta_avge_mass "1.9868" xref: delta_composition "N(-2) 15N(2)" xref: username_of_poster "ppicotti" xref: group_of_poster "" xref: date_time_posted "2010-06-22 15:29:02" xref: date_time_modified "2011-11-21 14:26:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Q" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "W" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:996 name: Label:15N(3) def: "15N(3)." [PMID:19664813, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=996] synonym: "Metabolic labeling with ammonium sulfate (15N)" [] xref: record_id "996" xref: delta_mono_mass "2.991105" xref: delta_avge_mass "2.9802" xref: delta_composition "N(-3) 15N(3)" xref: username_of_poster "ppicotti" xref: group_of_poster "" xref: date_time_posted "2010-06-22 15:30:28" xref: date_time_modified "2011-11-21 14:26:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:997 name: sulfo+amino def: "Aminotyrosine with sulfation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=997] synonym: "amino_sulfate" [] xref: record_id "997" xref: delta_mono_mass "94.967714" xref: delta_avge_mass "95.0778" xref: delta_composition "H N O(3) S" xref: username_of_poster "huidouzi" xref: group_of_poster "" xref: date_time_posted "2010-06-23 18:50:14" xref: date_time_modified "2010-06-28 10:29:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1000 name: AHA-Alkyne def: "Azidohomoalanine (AHA) bound to propargylglycine-NH2 (alkyne)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1000] comment: Methionine (C5H11NO2S) is substituted in culture with azidohomoalanine (AHA - C4H8N4O2). The azide group reacts with the alkyne group propargylglycine-NH2. As a result the side chain of methionine (C3H7S) is substituted by C7H12N5O. xref: record_id "1000" xref: delta_mono_mass "107.077339" xref: delta_avge_mass "107.0504" xref: delta_composition "H(5) C(4) N(5) O S(-1)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-09-28 09:28:15" xref: date_time_modified "2010-10-03 13:44:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1001 name: AHA-Alkyne-KDDDD def: "Azidohomoalanine (AHA) bound to DDDDK-propargylglycine-NH2 (alkyne)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1001] comment: Methionine (C5H11NO2S) is substituted in culture with azidohomoalanine (AHA - C4H8N4O2). The azide group reacts with the alkyne group DDDDK-propargylglycine-NH2. As a result the side chain of methionine (C3H7S) is substituted by C29H44N11O14. xref: record_id "1001" xref: delta_mono_mass "695.280074" xref: delta_avge_mass "695.5723" xref: delta_composition "H(37) C(26) N(11) O(14) S(-1)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-09-28 09:35:48" xref: date_time_modified "2010-10-03 13:44:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1002 name: EGCG1 def: "(-)-epigallocatechin-3-gallate." [PMID:18771724, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1002] comment: Created for Bindu Abraham 2010-10-05. xref: record_id "1002" xref: delta_mono_mass "456.069261" xref: delta_avge_mass "456.3558" xref: delta_composition "H(16) C(22) O(11)" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2010-10-05 20:46:40" xref: date_time_modified "2010-12-23 15:47:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1003 name: EGCG2 def: "(-)-dehydroepigallocatechin." [PMID:18771724, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1003] comment: Created for Bindu Abraham 2010-10-05. xref: record_id "1003" xref: delta_mono_mass "287.055563" xref: delta_avge_mass "287.2442" xref: delta_composition "H(11) C(15) O(6)" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2010-10-05 20:48:38" xref: date_time_modified "2010-12-23 15:47:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1004 name: Label:13C(6)15N(4)+Methyl def: "Monomethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1004] xref: record_id "1004" xref: delta_mono_mass "24.023919" xref: delta_avge_mass "23.9561" xref: delta_composition "H(2) C(-5) 13C(6) N(-4) 15N(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-10-27 10:36:31" xref: date_time_modified "2010-11-05 16:47:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1005 name: Label:13C(6)15N(4)+Dimethyl def: "Dimethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1005] xref: record_id "1005" xref: delta_mono_mass "38.039569" xref: delta_avge_mass "37.9827" xref: delta_composition "H(4) C(-4) 13C(6) N(-4) 15N(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-10-27 10:52:10" xref: date_time_modified "2010-11-05 16:49:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1006 name: Label:13C(6)15N(4)+Methyl:2H(3)13C(1) def: "2H(3) 13C(1) monomethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1006] xref: record_id "1006" xref: delta_mono_mass "28.046104" xref: delta_avge_mass "27.9673" xref: delta_composition "H(-1) 2H(3) C(-6) 13C(7) N(-4) 15N(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-10-27 10:59:21" xref: date_time_modified "2010-11-05 16:53:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1007 name: Label:13C(6)15N(4)+Dimethyl:2H(6)13C(2) def: "2H(6) 13C(2) Dimethylated Arg13C(6) 15N(4)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1007] xref: record_id "1007" xref: delta_mono_mass "46.083939" xref: delta_avge_mass "46.005" xref: delta_composition "H(-2) 2H(6) C(-6) 13C(8) N(-4) 15N(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-10-27 11:07:29" xref: date_time_modified "2010-11-05 16:54:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1008 name: Cys->CamSec def: "Sec Iodoacetamide derivative." [PMID:18283440, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1008] synonym: "Carboxyamidomethylation of selenocysteine" [] xref: record_id "1008" xref: delta_mono_mass "104.965913" xref: delta_avge_mass "103.9463" xref: delta_composition "H(3) C(2) N O S(-1) Se" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-11-04 12:00:12" xref: date_time_modified "2016-02-01 14:19:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1009 name: Thiazolidine def: "Formaldehyde adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1009] synonym: "thiazolidine-2-carboxylic acid" [] xref: record_id "1009" xref: delta_mono_mass "12" xref: delta_avge_mass "12.0107" xref: delta_composition "C" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2010-11-04 12:29:10" xref: date_time_modified "2017-03-30 16:37:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "H" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "W" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "F" xref: spec_8_position "Anywhere" xref: spec_8_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1010 name: DEDGFLYMVYASQETFG def: "Addition of DEDGFLYMVYASQETFG." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1010] xref: record_id "1010" xref: delta_mono_mass "1970.824411" xref: delta_avge_mass "1972.088" xref: delta_composition "H(122) C(89) N(18) O(31) S" xref: username_of_poster "hbromage" xref: group_of_poster "" xref: date_time_posted "2010-11-04 17:27:46" xref: date_time_modified "2010-11-24 18:00:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_neutral_loss_19_mono_mass "18.010565" xref: spec_1_neutral_loss_19_avge_mass "18.0153" xref: spec_1_neutral_loss_19_flag "false" xref: spec_1_neutral_loss_19_composition "Water" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1012 name: Biotin:Invitrogen-M1602 def: "Nalpha-(3-maleimidylpropionyl)biocytin." [URL:http\://products.invitrogen.com/ivgn/product/M1602?ICID=search-m1602, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1012] synonym: "Reference M1602 Invitrogen" [] xref: record_id "1012" xref: delta_mono_mass "523.210069" xref: delta_avge_mass "523.6024" xref: delta_composition "H(33) C(23) N(5) O(7) S" xref: username_of_poster "camoin" xref: group_of_poster "" xref: date_time_posted "2010-11-16 10:11:53" xref: date_time_modified "2010-12-03 15:58:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1014 name: glycidamide def: "Glycidamide adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1014] xref: record_id "1014" xref: delta_mono_mass "87.032028" xref: delta_avge_mass "87.0773" xref: delta_composition "H(5) C(3) N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2010-12-21 17:00:41" xref: date_time_modified "2010-12-21 17:00:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1015 name: Ahx2+Hsl def: "C-terminal homoserine lactone and two aminohexanoic acids." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1015] xref: record_id "1015" xref: delta_mono_mass "309.205242" xref: delta_avge_mass "309.4039" xref: delta_composition "H(27) C(16) N(3) O(3)" xref: username_of_poster "kpkent" xref: group_of_poster "" xref: date_time_posted "2010-12-22 10:13:01" xref: date_time_modified "2011-01-07 17:06:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Non-standard residue" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1017 name: DMPO def: "DMPO spin-trap nitrone adduct." [PMID:18160050, PMID:17637042, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1017] comment: Created for Bindu Abraham 2011-01-25. xref: record_id "1017" xref: delta_mono_mass "111.068414" xref: delta_avge_mass "111.1418" xref: delta_composition "H(9) C(6) N O" xref: username_of_poster "hooverdm" xref: group_of_poster "" xref: date_time_posted "2011-01-25 18:30:32" xref: date_time_modified "2011-02-28 17:17:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1018 name: ICDID def: "Isotope-Coded Dimedone light form." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1018] xref: record_id "1018" xref: delta_mono_mass "138.06808" xref: delta_avge_mass "138.1638" xref: delta_composition "H(10) C(8) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-02-02 17:23:34" xref: date_time_modified "2011-02-02 17:23:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1019 name: ICDID:2H(6) def: "Isotope-Coded Dimedone heavy form." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1019] xref: record_id "1019" xref: delta_mono_mass "144.10574" xref: delta_avge_mass "144.2008" xref: delta_composition "H(4) 2H(6) C(8) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-02-02 17:24:45" xref: date_time_modified "2011-02-02 17:24:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1020 name: Xlink:DSS[156] def: "Water-quenched monolink of DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1020] xref: record_id "1020" xref: delta_mono_mass "156.078644" xref: delta_avge_mass "156.1791" xref: delta_composition "H(12) C(8) O(3)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-07 14:20:22" xref: date_time_modified "2017-08-17 15:09:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1021 name: Xlink:EGS[244] def: "Water quenched monolink of EGS cross-linker." [PMID:36892, URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011281_EGS_SulfoEGS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1021] synonym: "Ethylene glycolbis(succinimidylsuccinate)" [] xref: record_id "1021" xref: delta_mono_mass "244.058303" xref: delta_avge_mass "244.1981" xref: delta_composition "H(12) C(10) O(7)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-07 17:40:36" xref: date_time_modified "2017-08-17 15:10:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1022 name: Xlink:DST[132] def: "Water quenched monolink of DST crosslinker." [PMID:212103, URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011282_DST_UG.pdf, PMID:3001048, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1022] xref: record_id "1022" xref: delta_mono_mass "132.005873" xref: delta_avge_mass "132.0716" xref: delta_composition "H(4) C(4) O(5)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-07 18:02:58" xref: date_time_modified "2017-08-18 14:26:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1023 name: Xlink:DTSSP[192] def: "Water quenched monolink of DSP/DTSSP crosslinker." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, PMID:1262347, PMID:8457554, PMID:322714, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1023] synonym: "Also known as DSP" [] xref: record_id "1023" xref: delta_mono_mass "191.991486" xref: delta_avge_mass "192.2559" xref: delta_composition "H(8) C(6) O(3) S(2)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-07 18:22:31" xref: date_time_modified "2017-08-18 14:53:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1024 name: Xlink:SMCC[237] def: "Water quenched monolink of SMCC." [PMID:6490581, PMID:1931231, URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011295_SMCC_SulfoSMCC_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1024] xref: record_id "1024" xref: delta_mono_mass "237.100108" xref: delta_avge_mass "237.2518" xref: delta_composition "H(15) C(12) N O(4)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-07 19:33:39" xref: date_time_modified "2017-09-05 15:09:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1027 name: Xlink:DMP[140] def: "Water quenched monolink of DMP crosslinker." [PMID:2144419, PMID:14696200, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1027] synonym: "Dimethyl pimelimidate dead-end crosslink" [] xref: record_id "1027" xref: delta_mono_mass "140.094963" xref: delta_avge_mass "140.183" xref: delta_composition "H(12) C(7) N(2) O" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-25 16:18:13" xref: date_time_modified "2017-08-18 10:17:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1028 name: Xlink:EGS[115] def: "Cleavage product of EGS protein crosslinks by hydroylamine treatment." [PMID:36892, URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011281_EGS_SulfoEGS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1028] synonym: "Ethylene glycolbis(succinimidylsuccinate)" [] xref: record_id "1028" xref: delta_mono_mass "115.026943" xref: delta_avge_mass "115.0874" xref: delta_composition "H(5) C(4) N O(3)" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2011-02-25 17:16:45" xref: date_time_modified "2017-08-17 15:10:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1031 name: Biotin:Thermo-88310 def: "Desthiobiotin modification of lysine." [URL:http\://www.lifetechnologies.com/order/catalog/product/88310, URL:http\://www.lifetechnologies.com/order/catalog/product/88314, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1031] synonym: "desthiobiotin-GTP desthiobiotin-ADP desthiobiotin-ATP" [] xref: record_id "1031" xref: delta_mono_mass "196.121178" xref: delta_avge_mass "196.2462" xref: delta_composition "H(16) C(10) N(2) O(2)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2011-03-02 20:33:20" xref: date_time_modified "2015-04-20 16:11:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1032 name: 2-nitrobenzyl def: "Tyrosine caged with 2-nitrobenzyl (ONB)." [PMID:16548032, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1032] xref: record_id "1032" xref: delta_mono_mass "135.032028" xref: delta_avge_mass "135.1201" xref: delta_composition "H(5) C(7) N O(2)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-03-14 10:56:33" xref: date_time_modified "2011-03-18 13:39:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1033 name: Cys->SecNEM def: "N-ethylmaleimide on selenocysteines." [URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:18283440, PMID:12777388, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1033] synonym: "SecNEM" [] xref: record_id "1033" xref: delta_mono_mass "172.992127" xref: delta_avge_mass "172.0203" xref: delta_composition "H(7) C(6) N O(2) S(-1) Se" xref: username_of_poster "mpcusack" xref: group_of_poster "" xref: date_time_posted "2011-03-31 18:29:45" xref: date_time_modified "2016-02-01 14:20:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1034 name: Cys->SecNEM:2H(5) def: "D5 N-ethylmaleimide on selenocysteines." [PMID:18283440, PMID:12777388, URL:http\://www.chemistry.ucsc.edu/~fink/231/Image118.gif, PMID:11813307, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1034] synonym: "SecNEM D5" [] xref: record_id "1034" xref: delta_mono_mass "178.023511" xref: delta_avge_mass "177.0511" xref: delta_composition "H(2) 2H(5) C(6) N O(2) S(-1) Se" xref: username_of_poster "mpcusack" xref: group_of_poster "" xref: date_time_posted "2011-03-31 18:32:32" xref: date_time_modified "2016-02-01 14:20:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1035 name: Thiadiazole def: "Thiadiazolydation of Cys." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1035] xref: record_id "1035" xref: delta_mono_mass "174.025169" xref: delta_avge_mass "174.2223" xref: delta_composition "H(6) C(9) N(2) S" xref: username_of_poster "cbatthya" xref: group_of_poster "" xref: date_time_posted "2011-04-01 16:26:52" xref: date_time_modified "2011-04-08 16:38:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1036 name: Withaferin def: "Modification of cystein by withaferin." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/21432907, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1036] xref: record_id "1036" xref: delta_mono_mass "470.266839" xref: delta_avge_mass "470.5977" xref: delta_composition "H(38) C(28) O(6)" xref: username_of_poster "ProtUA" xref: group_of_poster "" xref: date_time_posted "2011-04-06 12:31:40" xref: date_time_modified "2011-04-08 16:37:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1037 name: Biotin:Thermo-88317 def: "Desthiobiotin fluorophosphonate." [URL:http\://www.lifetechnologies.com/order/catalog/product/88317, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1037] comment: Dethiobiotin-FP was designed to label the active site serine of serine hydrolases (e.g. esterases, peptidases, lipases). synonym: "desthiobiotin-alkyl-FP desthiobiotin-FP" [] xref: record_id "1037" xref: delta_mono_mass "443.291294" xref: delta_avge_mass "443.5603" xref: delta_composition "H(42) C(22) N(3) O(4) P" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2011-05-06 19:40:48" xref: date_time_modified "2015-04-20 16:24:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1038 name: TAMRA-FP def: "TAMRA fluorophosphonate modification of serine." [URL:http\://www.piercenet.com/browse.cfm?fldID=0842EF3A-D867-AEA2-6E77-E84116CAA87C, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1038] comment: TAMRA-FP was designed to label the active site serine of serine hydrolases (e.g. esterases, peptidases, lipases). synonym: "ActivX TAMRA-FP Serine Hydrolase Probe TAMRA-alkyl-FP" [] xref: record_id "1038" xref: delta_mono_mass "659.312423" xref: delta_avge_mass "659.7514" xref: delta_composition "H(46) C(37) N(3) O(6) P" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2011-05-06 20:03:27" xref: date_time_modified "2011-05-09 16:01:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Y" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1039 name: Biotin:Thermo-21901+H2O def: "Maleimide-Biotin + Water." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1039] synonym: "Maleimide-PEG2-Biotin + Water" [] xref: record_id "1039" xref: delta_mono_mass "543.236284" xref: delta_avge_mass "543.6336" xref: delta_composition "H(37) C(23) N(5) O(8) S" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-05-18 16:28:42" xref: date_time_modified "2011-05-25 16:02:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1041 name: Deoxyhypusine def: "Deoxyhypusine." [PMID:20942800, PMID:10542236, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1041] comment: Deoxyhypusine synthase catalyzes the formation of a deoxyhypusine by transferring an aminobutyl moiety from spermidine onto a conserved lysine residue within the eIF5A. xref: record_id "1041" xref: delta_mono_mass "71.073499" xref: delta_avge_mass "71.121" xref: delta_composition "H(9) C(4) N" xref: username_of_poster "cbarrero" xref: group_of_poster "" xref: date_time_posted "2011-06-15 12:04:35" xref: date_time_modified "2015-01-12 16:03:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "Q" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_2_misc_notes "putrescine Q-PUT" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1042 name: Acetyldeoxyhypusine def: "Acetyldeoxyhypusine." [PMID:20942800, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1042] comment: Regulation of eIF5A by deoxyhypusine acetylation/deacetylation. xref: record_id "1042" xref: delta_mono_mass "97.089149" xref: delta_avge_mass "97.1582" xref: delta_composition "H(11) C(6) N" xref: username_of_poster "cbarrero" xref: group_of_poster "" xref: date_time_posted "2011-06-18 04:14:19" xref: date_time_modified "2011-06-25 03:10:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1043 name: Acetylhypusine def: "Acetylhypusine." [PMID:20942800, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1043] comment: Regulation of eIF5A by hypusine acetylation/deacetylation. xref: record_id "1043" xref: delta_mono_mass "113.084064" xref: delta_avge_mass "113.1576" xref: delta_composition "H(11) C(6) N O" xref: username_of_poster "cbarrero" xref: group_of_poster "" xref: date_time_posted "2011-06-18 04:16:59" xref: date_time_modified "2011-06-25 03:11:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1044 name: Ala->Cys def: "Ala->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1044] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1044" xref: delta_mono_mass "31.972071" xref: delta_avge_mass "32.065" xref: delta_composition "S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:49:30" xref: date_time_modified "2011-06-20 16:49:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1045 name: Ala->Phe def: "Ala->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1045] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1045" xref: delta_mono_mass "76.0313" xref: delta_avge_mass "76.096" xref: delta_composition "H(4) C(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:50:25" xref: date_time_modified "2011-06-20 16:50:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1046 name: Ala->His def: "Ala->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1046] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1046" xref: delta_mono_mass "66.021798" xref: delta_avge_mass "66.0614" xref: delta_composition "H(2) C(3) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:56:21" xref: date_time_modified "2011-06-20 16:56:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1047 name: Ala->Xle def: "Ala->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1047] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1047" xref: delta_mono_mass "42.04695" xref: delta_avge_mass "42.0797" xref: delta_composition "H(6) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:57:10" xref: date_time_modified "2011-06-21 15:12:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1048 name: Ala->Lys def: "Ala->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1048] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1048" xref: delta_mono_mass "57.057849" xref: delta_avge_mass "57.0944" xref: delta_composition "H(7) C(3) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:57:37" xref: date_time_modified "2011-06-20 16:57:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1049 name: Ala->Met def: "Ala->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1049] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1049" xref: delta_mono_mass "60.003371" xref: delta_avge_mass "60.1182" xref: delta_composition "H(4) C(2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:58:05" xref: date_time_modified "2011-06-20 16:58:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1050 name: Ala->Asn def: "Ala->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1050] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1050" xref: delta_mono_mass "43.005814" xref: delta_avge_mass "43.0247" xref: delta_composition "H C N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:58:32" xref: date_time_modified "2011-06-20 16:58:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1051 name: Ala->Gln def: "Ala->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1051] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1051" xref: delta_mono_mass "57.021464" xref: delta_avge_mass "57.0513" xref: delta_composition "H(3) C(2) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:58:56" xref: date_time_modified "2011-06-20 16:58:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1052 name: Ala->Arg def: "Ala->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1052] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1052" xref: delta_mono_mass "85.063997" xref: delta_avge_mass "85.1078" xref: delta_composition "H(7) C(3) N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:59:22" xref: date_time_modified "2011-06-20 16:59:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1053 name: Ala->Trp def: "Ala->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1053] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1053" xref: delta_mono_mass "115.042199" xref: delta_avge_mass "115.132" xref: delta_composition "H(5) C(8) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 16:59:45" xref: date_time_modified "2011-06-20 16:59:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1054 name: Ala->Tyr def: "Ala->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1054] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1054" xref: delta_mono_mass "92.026215" xref: delta_avge_mass "92.0954" xref: delta_composition "H(4) C(6) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:00:09" xref: date_time_modified "2011-06-20 17:00:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1055 name: Cys->Ala def: "Cys->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1055] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1055" xref: delta_mono_mass "-31.972071" xref: delta_avge_mass "-32.065" xref: delta_composition "S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:26:22" xref: date_time_modified "2011-06-20 17:26:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1056 name: Cys->Asp def: "Cys->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1056] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1056" xref: delta_mono_mass "12.017759" xref: delta_avge_mass "11.9445" xref: delta_composition "C O(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:26:57" xref: date_time_modified "2011-06-20 17:26:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1057 name: Cys->Glu def: "Cys->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1057] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1057" xref: delta_mono_mass "26.033409" xref: delta_avge_mass "25.9711" xref: delta_composition "H(2) C(2) O(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:27:25" xref: date_time_modified "2011-06-20 17:27:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1058 name: Cys->His def: "Cys->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1058] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1058" xref: delta_mono_mass "34.049727" xref: delta_avge_mass "33.9964" xref: delta_composition "H(2) C(3) N(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:27:48" xref: date_time_modified "2011-06-20 17:27:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1059 name: Cys->Xle def: "Cys->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1059] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1059" xref: delta_mono_mass "10.07488" xref: delta_avge_mass "10.0147" xref: delta_composition "H(6) C(3) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:28:11" xref: date_time_modified "2011-06-21 15:14:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1060 name: Cys->Lys def: "Cys->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1060] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1060" xref: delta_mono_mass "25.085779" xref: delta_avge_mass "25.0294" xref: delta_composition "H(7) C(3) N S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:28:36" xref: date_time_modified "2011-06-20 17:28:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1061 name: Cys->Met def: "Cys->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1061] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1061" xref: delta_mono_mass "28.0313" xref: delta_avge_mass "28.0532" xref: delta_composition "H(4) C(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:29:04" xref: date_time_modified "2011-06-20 17:29:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1062 name: Cys->Asn def: "Cys->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1062] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1062" xref: delta_mono_mass "11.033743" xref: delta_avge_mass "10.9597" xref: delta_composition "H C N O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:29:28" xref: date_time_modified "2011-06-20 17:29:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1063 name: Cys->Pro def: "Cys->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1063] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1063" xref: delta_mono_mass "-5.956421" xref: delta_avge_mass "-6.0277" xref: delta_composition "H(2) C(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:29:55" xref: date_time_modified "2011-06-20 17:29:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1064 name: Cys->Gln def: "Cys->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1064] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1064" xref: delta_mono_mass "25.049393" xref: delta_avge_mass "24.9863" xref: delta_composition "H(3) C(2) N O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:30:19" xref: date_time_modified "2011-06-20 17:30:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1065 name: Cys->Thr def: "Cys->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1065] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1065" xref: delta_mono_mass "-1.961506" xref: delta_avge_mass "-2.039" xref: delta_composition "H(2) C O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:30:53" xref: date_time_modified "2011-06-20 17:30:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1066 name: Cys->Val def: "Cys->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1066] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1066" xref: delta_mono_mass "-3.940771" xref: delta_avge_mass "-4.0118" xref: delta_composition "H(4) C(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:31:23" xref: date_time_modified "2011-06-20 17:31:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1067 name: Asp->Cys def: "Asp->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1067] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1067" xref: delta_mono_mass "-12.017759" xref: delta_avge_mass "-11.9445" xref: delta_composition "C(-1) O(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:40:11" xref: date_time_modified "2011-06-20 17:40:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1068 name: Asp->Phe def: "Asp->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1068] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1068" xref: delta_mono_mass "32.041471" xref: delta_avge_mass "32.0865" xref: delta_composition "H(4) C(5) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:40:35" xref: date_time_modified "2011-06-20 17:40:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1069 name: Asp->Xle def: "Asp->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1069] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1069" xref: delta_mono_mass "-1.942879" xref: delta_avge_mass "-1.9298" xref: delta_composition "H(6) C(2) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:41:00" xref: date_time_modified "2011-06-21 15:14:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1070 name: Asp->Lys def: "Asp->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1070] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1070" xref: delta_mono_mass "13.06802" xref: delta_avge_mass "13.0849" xref: delta_composition "H(7) C(2) N O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:41:26" xref: date_time_modified "2011-06-20 17:41:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1071 name: Asp->Met def: "Asp->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1071] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1071" xref: delta_mono_mass "16.013542" xref: delta_avge_mass "16.1087" xref: delta_composition "H(4) C O(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:41:51" xref: date_time_modified "2011-06-20 17:41:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1072 name: Asp->Pro def: "Asp->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1072] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1072" xref: delta_mono_mass "-17.974179" xref: delta_avge_mass "-17.9722" xref: delta_composition "H(2) C O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:42:17" xref: date_time_modified "2011-06-20 17:42:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1073 name: Asp->Gln def: "Asp->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1073] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1073" xref: delta_mono_mass "13.031634" xref: delta_avge_mass "13.0418" xref: delta_composition "H(3) C N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:42:41" xref: date_time_modified "2011-06-20 17:42:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1074 name: Asp->Arg def: "Asp->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1074] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1074" xref: delta_mono_mass "41.074168" xref: delta_avge_mass "41.0983" xref: delta_composition "H(7) C(2) N(3) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:43:03" xref: date_time_modified "2011-06-20 17:43:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1075 name: Asp->Ser def: "Asp->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1075] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1075" xref: delta_mono_mass "-27.994915" xref: delta_avge_mass "-28.0101" xref: delta_composition "C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:43:25" xref: date_time_modified "2011-06-20 17:43:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1076 name: Asp->Thr def: "Asp->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1076] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1076" xref: delta_mono_mass "-13.979265" xref: delta_avge_mass "-13.9835" xref: delta_composition "H(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:43:51" xref: date_time_modified "2011-06-20 17:43:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1077 name: Asp->Trp def: "Asp->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1077] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1077" xref: delta_mono_mass "71.05237" xref: delta_avge_mass "71.1225" xref: delta_composition "H(5) C(7) N O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-20 17:44:16" xref: date_time_modified "2011-06-20 17:44:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1078 name: Glu->Cys def: "Glu->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1078] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1078" xref: delta_mono_mass "-26.033409" xref: delta_avge_mass "-25.9711" xref: delta_composition "H(-2) C(-2) O(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:00:46" xref: date_time_modified "2011-06-21 12:00:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1079 name: Glu->Phe def: "Glu->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1079] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1079" xref: delta_mono_mass "18.025821" xref: delta_avge_mass "18.0599" xref: delta_composition "H(2) C(4) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:01:12" xref: date_time_modified "2011-06-21 12:01:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1080 name: Glu->His def: "Glu->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1080] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1080" xref: delta_mono_mass "8.016319" xref: delta_avge_mass "8.0253" xref: delta_composition "C N(2) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:01:42" xref: date_time_modified "2011-06-21 12:01:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1081 name: Glu->Xle def: "Glu->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1081] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1081" xref: delta_mono_mass "-15.958529" xref: delta_avge_mass "-15.9563" xref: delta_composition "H(4) C O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:02:09" xref: date_time_modified "2011-06-21 15:15:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1082 name: Glu->Met def: "Glu->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1082] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1082" xref: delta_mono_mass "1.997892" xref: delta_avge_mass "2.0821" xref: delta_composition "H(2) O(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:02:35" xref: date_time_modified "2011-06-21 12:02:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1083 name: Glu->Asn def: "Glu->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1083] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1083" xref: delta_mono_mass "-14.999666" xref: delta_avge_mass "-15.0113" xref: delta_composition "H(-1) C(-1) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:03:01" xref: date_time_modified "2011-06-21 12:03:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1084 name: Glu->Pro def: "Glu->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1084] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1084" xref: delta_mono_mass "-31.989829" xref: delta_avge_mass "-31.9988" xref: delta_composition "O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:03:25" xref: date_time_modified "2011-06-21 12:03:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1085 name: Glu->Arg def: "Glu->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1085] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1085" xref: delta_mono_mass "27.058518" xref: delta_avge_mass "27.0717" xref: delta_composition "H(5) C N(3) O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:03:48" xref: date_time_modified "2011-06-21 12:03:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1086 name: Glu->Ser def: "Glu->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1086] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1086" xref: delta_mono_mass "-42.010565" xref: delta_avge_mass "-42.0367" xref: delta_composition "H(-2) C(-2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:04:12" xref: date_time_modified "2011-06-21 12:04:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1087 name: Glu->Thr def: "Glu->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1087] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1087" xref: delta_mono_mass "-27.994915" xref: delta_avge_mass "-28.0101" xref: delta_composition "C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:04:38" xref: date_time_modified "2011-06-21 12:04:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1088 name: Glu->Trp def: "Glu->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1088] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1088" xref: delta_mono_mass "57.03672" xref: delta_avge_mass "57.0959" xref: delta_composition "H(3) C(6) N O(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:05:01" xref: date_time_modified "2011-06-21 12:05:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1089 name: Glu->Tyr def: "Glu->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1089] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1089" xref: delta_mono_mass "34.020735" xref: delta_avge_mass "34.0593" xref: delta_composition "H(2) C(4) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 12:05:23" xref: date_time_modified "2011-06-21 12:05:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1090 name: Phe->Ala def: "Phe->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1090] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1090" xref: delta_mono_mass "-76.0313" xref: delta_avge_mass "-76.096" xref: delta_composition "H(-4) C(-6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:41:15" xref: date_time_modified "2011-06-21 13:41:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1091 name: Phe->Asp def: "Phe->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1091] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1091" xref: delta_mono_mass "-32.041471" xref: delta_avge_mass "-32.0865" xref: delta_composition "H(-4) C(-5) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:41:48" xref: date_time_modified "2011-06-21 13:41:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1092 name: Phe->Glu def: "Phe->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1092] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1092" xref: delta_mono_mass "-18.025821" xref: delta_avge_mass "-18.0599" xref: delta_composition "H(-2) C(-4) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:56:57" xref: date_time_modified "2011-06-21 13:56:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1093 name: Phe->Gly def: "Phe->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1093] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1093" xref: delta_mono_mass "-90.04695" xref: delta_avge_mass "-90.1225" xref: delta_composition "H(-6) C(-7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:57:23" xref: date_time_modified "2011-06-21 13:57:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1094 name: Phe->His def: "Phe->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1094] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1094" xref: delta_mono_mass "-10.009502" xref: delta_avge_mass "-10.0346" xref: delta_composition "H(-2) C(-3) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:57:45" xref: date_time_modified "2011-06-21 13:57:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1095 name: Phe->Lys def: "Phe->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1095] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1095" xref: delta_mono_mass "-18.973451" xref: delta_avge_mass "-19.0016" xref: delta_composition "H(3) C(-3) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:58:10" xref: date_time_modified "2011-06-21 13:58:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1096 name: Phe->Met def: "Phe->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1096] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1096" xref: delta_mono_mass "-16.027929" xref: delta_avge_mass "-15.9778" xref: delta_composition "C(-4) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:58:32" xref: date_time_modified "2011-06-21 13:58:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1097 name: Phe->Asn def: "Phe->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1097] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1097" xref: delta_mono_mass "-33.025486" xref: delta_avge_mass "-33.0712" xref: delta_composition "H(-3) C(-5) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:58:57" xref: date_time_modified "2011-06-21 13:58:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1098 name: Phe->Pro def: "Phe->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1098] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1098" xref: delta_mono_mass "-50.01565" xref: delta_avge_mass "-50.0587" xref: delta_composition "H(-2) C(-4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:59:19" xref: date_time_modified "2011-06-21 13:59:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1099 name: Phe->Gln def: "Phe->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1099] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1099" xref: delta_mono_mass "-19.009836" xref: delta_avge_mass "-19.0446" xref: delta_composition "H(-1) C(-4) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 13:59:42" xref: date_time_modified "2011-06-21 13:59:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1100 name: Phe->Arg def: "Phe->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1100] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1100" xref: delta_mono_mass "9.032697" xref: delta_avge_mass "9.0118" xref: delta_composition "H(3) C(-3) N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:00:05" xref: date_time_modified "2011-06-21 14:00:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1101 name: Phe->Thr def: "Phe->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1101] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1101" xref: delta_mono_mass "-46.020735" xref: delta_avge_mass "-46.07" xref: delta_composition "H(-2) C(-5) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:00:30" xref: date_time_modified "2011-06-21 14:00:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1102 name: Phe->Trp def: "Phe->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1102] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1102" xref: delta_mono_mass "39.010899" xref: delta_avge_mass "39.036" xref: delta_composition "H C(2) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:00:53" xref: date_time_modified "2011-06-21 14:00:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1103 name: Gly->Phe def: "Gly->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1103] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1103" xref: delta_mono_mass "90.04695" xref: delta_avge_mass "90.1225" xref: delta_composition "H(6) C(7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:03:41" xref: date_time_modified "2011-06-21 14:03:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1104 name: Gly->His def: "Gly->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1104] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1104" xref: delta_mono_mass "80.037448" xref: delta_avge_mass "80.088" xref: delta_composition "H(4) C(4) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:04:05" xref: date_time_modified "2011-06-21 14:04:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1105 name: Gly->Xle def: "Gly->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1105] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1105" xref: delta_mono_mass "56.0626" xref: delta_avge_mass "56.1063" xref: delta_composition "H(8) C(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:04:27" xref: date_time_modified "2011-06-21 15:15:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1106 name: Gly->Lys def: "Gly->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1106] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1106" xref: delta_mono_mass "71.073499" xref: delta_avge_mass "71.121" xref: delta_composition "H(9) C(4) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:04:51" xref: date_time_modified "2011-06-21 14:04:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1107 name: Gly->Met def: "Gly->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1107] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1107" xref: delta_mono_mass "74.019021" xref: delta_avge_mass "74.1447" xref: delta_composition "H(6) C(3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:05:16" xref: date_time_modified "2011-06-21 14:05:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1108 name: Gly->Asn def: "Gly->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1108] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1108" xref: delta_mono_mass "57.021464" xref: delta_avge_mass "57.0513" xref: delta_composition "H(3) C(2) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:05:35" xref: date_time_modified "2011-06-21 14:05:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1109 name: Gly->Pro def: "Gly->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1109] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1109" xref: delta_mono_mass "40.0313" xref: delta_avge_mass "40.0639" xref: delta_composition "H(4) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:05:55" xref: date_time_modified "2011-06-21 14:05:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1110 name: Gly->Gln def: "Gly->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1110] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1110" xref: delta_mono_mass "71.037114" xref: delta_avge_mass "71.0779" xref: delta_composition "H(5) C(3) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:06:16" xref: date_time_modified "2011-06-21 14:06:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1111 name: Gly->Thr def: "Gly->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1111] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1111" xref: delta_mono_mass "44.026215" xref: delta_avge_mass "44.0526" xref: delta_composition "H(4) C(2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:06:40" xref: date_time_modified "2011-06-21 14:06:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1112 name: Gly->Tyr def: "Gly->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1112] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1112" xref: delta_mono_mass "106.041865" xref: delta_avge_mass "106.1219" xref: delta_composition "H(6) C(7) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:07:05" xref: date_time_modified "2011-06-21 14:07:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "G" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1113 name: His->Ala def: "His->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1113] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1113" xref: delta_mono_mass "-66.021798" xref: delta_avge_mass "-66.0614" xref: delta_composition "H(-2) C(-3) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:51:31" xref: date_time_modified "2011-06-21 14:51:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1114 name: His->Cys def: "His->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1114] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1114" xref: delta_mono_mass "-34.049727" xref: delta_avge_mass "-33.9964" xref: delta_composition "H(-2) C(-3) N(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:51:56" xref: date_time_modified "2011-06-21 14:51:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1115 name: His->Glu def: "His->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1115] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1115" xref: delta_mono_mass "-8.016319" xref: delta_avge_mass "-8.0253" xref: delta_composition "C(-1) N(-2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:52:16" xref: date_time_modified "2011-06-21 14:52:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1116 name: His->Phe def: "His->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1116] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1116" xref: delta_mono_mass "10.009502" xref: delta_avge_mass "10.0346" xref: delta_composition "H(2) C(3) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:52:50" xref: date_time_modified "2011-06-21 14:52:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1117 name: His->Gly def: "His->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1117] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1117" xref: delta_mono_mass "-80.037448" xref: delta_avge_mass "-80.088" xref: delta_composition "H(-4) C(-4) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:53:45" xref: date_time_modified "2011-06-21 14:53:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1119 name: His->Lys def: "His->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1119] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1119" xref: delta_mono_mass "-8.963949" xref: delta_avge_mass "-8.967" xref: delta_composition "H(5) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:59:08" xref: date_time_modified "2011-06-21 14:59:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1120 name: His->Met def: "His->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1120] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1120" xref: delta_mono_mass "-6.018427" xref: delta_avge_mass "-5.9432" xref: delta_composition "H(2) C(-1) N(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:59:30" xref: date_time_modified "2011-06-21 14:59:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1121 name: His->Ser def: "His->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1121] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1121" xref: delta_mono_mass "-50.026883" xref: delta_avge_mass "-50.062" xref: delta_composition "H(-2) C(-3) N(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 14:59:50" xref: date_time_modified "2011-06-21 14:59:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1122 name: His->Thr def: "His->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1122] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1122" xref: delta_mono_mass "-36.011233" xref: delta_avge_mass "-36.0354" xref: delta_composition "C(-2) N(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:00:20" xref: date_time_modified "2011-06-21 15:00:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1123 name: His->Val def: "His->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1123] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1123" xref: delta_mono_mass "-37.990498" xref: delta_avge_mass "-38.0082" xref: delta_composition "H(2) C(-1) N(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:00:41" xref: date_time_modified "2011-06-21 15:00:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1124 name: His->Trp def: "His->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1124] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1124" xref: delta_mono_mass "49.020401" xref: delta_avge_mass "49.0706" xref: delta_composition "H(3) C(5) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:01:02" xref: date_time_modified "2011-06-21 15:01:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1125 name: Xle->Ala def: "Leu/Ile->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1125] xref: record_id "1125" xref: delta_mono_mass "-42.04695" xref: delta_avge_mass "-42.0797" xref: delta_composition "H(-6) C(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:33:19" xref: date_time_modified "2011-06-21 15:33:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1126 name: Xle->Cys def: "Leu/Ile->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1126] xref: record_id "1126" xref: delta_mono_mass "-10.07488" xref: delta_avge_mass "-10.0147" xref: delta_composition "H(-6) C(-3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:33:43" xref: date_time_modified "2011-06-21 15:33:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1127 name: Xle->Asp def: "Leu/Ile->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1127] xref: record_id "1127" xref: delta_mono_mass "1.942879" xref: delta_avge_mass "1.9298" xref: delta_composition "H(-6) C(-2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:34:14" xref: date_time_modified "2011-06-21 15:34:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1128 name: Xle->Glu def: "Leu/Ile->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1128] xref: record_id "1128" xref: delta_mono_mass "15.958529" xref: delta_avge_mass "15.9563" xref: delta_composition "H(-4) C(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:34:40" xref: date_time_modified "2011-06-21 15:34:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1129 name: Xle->Gly def: "Leu/Ile->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1129] xref: record_id "1129" xref: delta_mono_mass "-56.0626" xref: delta_avge_mass "-56.1063" xref: delta_composition "H(-8) C(-4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:35:12" xref: date_time_modified "2011-06-21 15:35:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1130 name: Xle->Tyr def: "Leu/Ile->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1130] xref: record_id "1130" xref: delta_mono_mass "49.979265" xref: delta_avge_mass "50.0156" xref: delta_composition "H(-2) C(3) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:35:36" xref: date_time_modified "2011-06-21 15:35:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "I" xref: spec_2_position "Anywhere" xref: spec_2_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1131 name: Lys->Ala def: "Lys->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1131] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1131" xref: delta_mono_mass "-57.057849" xref: delta_avge_mass "-57.0944" xref: delta_composition "H(-7) C(-3) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 15:37:25" xref: date_time_modified "2011-06-21 15:37:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1132 name: Lys->Cys def: "Lys->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1132] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1132" xref: delta_mono_mass "-25.085779" xref: delta_avge_mass "-25.0294" xref: delta_composition "H(-7) C(-3) N(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:01:01" xref: date_time_modified "2011-06-21 16:01:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1133 name: Lys->Asp def: "Lys->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1133] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1133" xref: delta_mono_mass "-13.06802" xref: delta_avge_mass "-13.0849" xref: delta_composition "H(-7) C(-2) N(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:01:33" xref: date_time_modified "2011-06-21 16:01:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1134 name: Lys->Phe def: "Lys->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1134] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1134" xref: delta_mono_mass "18.973451" xref: delta_avge_mass "19.0016" xref: delta_composition "H(-3) C(3) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:01:56" xref: date_time_modified "2011-06-21 16:01:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1135 name: Lys->Gly def: "Lys->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1135] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1135" xref: delta_mono_mass "-71.073499" xref: delta_avge_mass "-71.121" xref: delta_composition "H(-9) C(-4) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:02:20" xref: date_time_modified "2011-06-21 16:02:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1136 name: Lys->His def: "Lys->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1136] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1136" xref: delta_mono_mass "8.963949" xref: delta_avge_mass "8.967" xref: delta_composition "H(-5) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:02:42" xref: date_time_modified "2011-06-21 16:02:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1137 name: Lys->Pro def: "Lys->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1137] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1137" xref: delta_mono_mass "-31.042199" xref: delta_avge_mass "-31.0571" xref: delta_composition "H(-5) C(-1) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:03:06" xref: date_time_modified "2011-06-21 16:03:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1138 name: Lys->Ser def: "Lys->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1138] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1138" xref: delta_mono_mass "-41.062935" xref: delta_avge_mass "-41.095" xref: delta_composition "H(-7) C(-3) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:03:27" xref: date_time_modified "2011-06-21 16:03:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1139 name: Lys->Val def: "Lys->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1139] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1139" xref: delta_mono_mass "-29.026549" xref: delta_avge_mass "-29.0412" xref: delta_composition "H(-3) C(-1) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:03:49" xref: date_time_modified "2011-06-21 16:03:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1140 name: Lys->Trp def: "Lys->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1140] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1140" xref: delta_mono_mass "57.98435" xref: delta_avge_mass "58.0376" xref: delta_composition "H(-2) C(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:04:11" xref: date_time_modified "2011-06-21 16:04:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1141 name: Lys->Tyr def: "Lys->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1141] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1141" xref: delta_mono_mass "34.968366" xref: delta_avge_mass "35.001" xref: delta_composition "H(-3) C(3) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:04:35" xref: date_time_modified "2011-06-21 16:04:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1142 name: Met->Ala def: "Met->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1142] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1142" xref: delta_mono_mass "-60.003371" xref: delta_avge_mass "-60.1182" xref: delta_composition "H(-4) C(-2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:28:27" xref: date_time_modified "2011-06-21 16:28:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1143 name: Met->Cys def: "Met->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1143] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1143" xref: delta_mono_mass "-28.0313" xref: delta_avge_mass "-28.0532" xref: delta_composition "H(-4) C(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:28:53" xref: date_time_modified "2011-06-21 16:28:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1144 name: Met->Asp def: "Met->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1144] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1144" xref: delta_mono_mass "-16.013542" xref: delta_avge_mass "-16.1087" xref: delta_composition "H(-4) C(-1) O(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:29:13" xref: date_time_modified "2011-06-21 16:29:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1145 name: Met->Glu def: "Met->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1145] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1145" xref: delta_mono_mass "-1.997892" xref: delta_avge_mass "-2.0821" xref: delta_composition "H(-2) O(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:29:35" xref: date_time_modified "2011-06-21 16:29:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1146 name: Met->Phe def: "Met->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1146] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1146" xref: delta_mono_mass "16.027929" xref: delta_avge_mass "15.9778" xref: delta_composition "C(4) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:30:07" xref: date_time_modified "2011-06-21 16:30:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1147 name: Met->Gly def: "Met->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1147] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1147" xref: delta_mono_mass "-74.019021" xref: delta_avge_mass "-74.1447" xref: delta_composition "H(-6) C(-3) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:30:29" xref: date_time_modified "2011-06-21 16:30:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1148 name: Met->His def: "Met->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1148] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1148" xref: delta_mono_mass "6.018427" xref: delta_avge_mass "5.9432" xref: delta_composition "H(-2) C N(2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:30:50" xref: date_time_modified "2011-06-21 16:30:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1149 name: Met->Asn def: "Met->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1149] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1149" xref: delta_mono_mass "-16.997557" xref: delta_avge_mass "-17.0934" xref: delta_composition "H(-3) C(-1) N O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:31:14" xref: date_time_modified "2011-06-21 16:31:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1150 name: Met->Pro def: "Met->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1150] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1150" xref: delta_mono_mass "-33.987721" xref: delta_avge_mass "-34.0809" xref: delta_composition "H(-2) S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:31:34" xref: date_time_modified "2011-06-21 16:31:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1151 name: Met->Gln def: "Met->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1151] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1151" xref: delta_mono_mass "-2.981907" xref: delta_avge_mass "-3.0668" xref: delta_composition "H(-1) N O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:31:55" xref: date_time_modified "2011-06-21 16:31:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1152 name: Met->Ser def: "Met->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1152] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1152" xref: delta_mono_mass "-44.008456" xref: delta_avge_mass "-44.1188" xref: delta_composition "H(-4) C(-2) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:32:16" xref: date_time_modified "2011-06-21 16:32:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1153 name: Met->Trp def: "Met->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1153] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1153" xref: delta_mono_mass "55.038828" xref: delta_avge_mass "55.0138" xref: delta_composition "H C(6) N S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:32:38" xref: date_time_modified "2011-06-21 16:32:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1154 name: Met->Tyr def: "Met->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1154] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1154" xref: delta_mono_mass "32.022844" xref: delta_avge_mass "31.9772" xref: delta_composition "C(4) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:33:00" xref: date_time_modified "2011-06-21 16:33:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1155 name: Asn->Ala def: "Asn->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1155] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1155" xref: delta_mono_mass "-43.005814" xref: delta_avge_mass "-43.0247" xref: delta_composition "H(-1) C(-1) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:36:38" xref: date_time_modified "2011-06-21 16:36:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1156 name: Asn->Cys def: "Asn->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1156] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1156" xref: delta_mono_mass "-11.033743" xref: delta_avge_mass "-10.9597" xref: delta_composition "H(-1) C(-1) N(-1) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:37:03" xref: date_time_modified "2011-06-21 16:37:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1157 name: Asn->Glu def: "Asn->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1157] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1157" xref: delta_mono_mass "14.999666" xref: delta_avge_mass "15.0113" xref: delta_composition "H C N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:37:26" xref: date_time_modified "2011-06-21 16:37:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1158 name: Asn->Phe def: "Asn->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1158] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1158" xref: delta_mono_mass "33.025486" xref: delta_avge_mass "33.0712" xref: delta_composition "H(3) C(5) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:37:48" xref: date_time_modified "2011-06-21 16:37:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1159 name: Asn->Gly def: "Asn->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1159] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1159" xref: delta_mono_mass "-57.021464" xref: delta_avge_mass "-57.0513" xref: delta_composition "H(-3) C(-2) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:38:11" xref: date_time_modified "2011-06-21 16:38:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1160 name: Asn->Met def: "Asn->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1160] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1160" xref: delta_mono_mass "16.997557" xref: delta_avge_mass "17.0934" xref: delta_composition "H(3) C N(-1) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:38:32" xref: date_time_modified "2011-06-21 16:38:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1161 name: Asn->Pro def: "Asn->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1161] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1161" xref: delta_mono_mass "-16.990164" xref: delta_avge_mass "-16.9875" xref: delta_composition "H C N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:38:54" xref: date_time_modified "2011-06-21 16:38:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1162 name: Asn->Gln def: "Asn->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1162] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1162" xref: delta_mono_mass "14.01565" xref: delta_avge_mass "14.0266" xref: delta_composition "H(2) C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:39:15" xref: date_time_modified "2011-06-21 16:39:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1163 name: Asn->Arg def: "Asn->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1163] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1163" xref: delta_mono_mass "42.058184" xref: delta_avge_mass "42.083" xref: delta_composition "H(6) C(2) N(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:39:37" xref: date_time_modified "2011-06-21 16:39:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1164 name: Asn->Val def: "Asn->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1164] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1164" xref: delta_mono_mass "-14.974514" xref: delta_avge_mass "-14.9716" xref: delta_composition "H(3) C N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:39:59" xref: date_time_modified "2011-06-21 16:39:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1165 name: Asn->Trp def: "Asn->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1165] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1165" xref: delta_mono_mass "72.036386" xref: delta_avge_mass "72.1073" xref: delta_composition "H(4) C(7) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:40:21" xref: date_time_modified "2011-06-21 16:40:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1166 name: Pro->Cys def: "Pro->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1166] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1166" xref: delta_mono_mass "5.956421" xref: delta_avge_mass "6.0277" xref: delta_composition "H(-2) C(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 16:59:55" xref: date_time_modified "2011-06-21 16:59:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1167 name: Pro->Asp def: "Pro->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1167] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1167" xref: delta_mono_mass "17.974179" xref: delta_avge_mass "17.9722" xref: delta_composition "H(-2) C(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:00:24" xref: date_time_modified "2011-06-21 17:00:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1168 name: Pro->Glu def: "Pro->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1168] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1168" xref: delta_mono_mass "31.989829" xref: delta_avge_mass "31.9988" xref: delta_composition "O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:26:36" xref: date_time_modified "2011-06-21 17:26:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1169 name: Pro->Phe def: "Pro->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1169] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1169" xref: delta_mono_mass "50.01565" xref: delta_avge_mass "50.0587" xref: delta_composition "H(2) C(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:26:56" xref: date_time_modified "2011-06-21 17:26:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1170 name: Pro->Gly def: "Pro->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1170] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1170" xref: delta_mono_mass "-40.0313" xref: delta_avge_mass "-40.0639" xref: delta_composition "H(-4) C(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:27:17" xref: date_time_modified "2011-06-21 17:27:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1171 name: Pro->Lys def: "Pro->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1171] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1171" xref: delta_mono_mass "31.042199" xref: delta_avge_mass "31.0571" xref: delta_composition "H(5) C N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:27:38" xref: date_time_modified "2011-06-21 17:27:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1172 name: Pro->Met def: "Pro->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1172] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1172" xref: delta_mono_mass "33.987721" xref: delta_avge_mass "34.0809" xref: delta_composition "H(2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:27:57" xref: date_time_modified "2011-06-21 17:27:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1173 name: Pro->Asn def: "Pro->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1173] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1173" xref: delta_mono_mass "16.990164" xref: delta_avge_mass "16.9875" xref: delta_composition "H(-1) C(-1) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:28:18" xref: date_time_modified "2011-06-21 17:28:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1174 name: Pro->Val def: "Pro->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1174] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1174" xref: delta_mono_mass "2.01565" xref: delta_avge_mass "2.0159" xref: delta_composition "H(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:28:41" xref: date_time_modified "2011-06-21 17:28:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1175 name: Pro->Trp def: "Pro->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1175] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1175" xref: delta_mono_mass "89.026549" xref: delta_avge_mass "89.0947" xref: delta_composition "H(3) C(6) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:29:04" xref: date_time_modified "2011-06-21 17:29:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1176 name: Pro->Tyr def: "Pro->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1176] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1176" xref: delta_mono_mass "66.010565" xref: delta_avge_mass "66.0581" xref: delta_composition "H(2) C(4) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:29:24" xref: date_time_modified "2011-06-21 17:29:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1177 name: Gln->Ala def: "Gln->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1177] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1177" xref: delta_mono_mass "-57.021464" xref: delta_avge_mass "-57.0513" xref: delta_composition "H(-3) C(-2) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:39:52" xref: date_time_modified "2011-06-21 17:39:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1178 name: Gln->Cys def: "Gln->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1178] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1178" xref: delta_mono_mass "-25.049393" xref: delta_avge_mass "-24.9863" xref: delta_composition "H(-3) C(-2) N(-1) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:40:20" xref: date_time_modified "2011-06-21 17:40:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1179 name: Gln->Asp def: "Gln->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1179] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1179" xref: delta_mono_mass "-13.031634" xref: delta_avge_mass "-13.0418" xref: delta_composition "H(-3) C(-1) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:40:42" xref: date_time_modified "2011-06-21 17:40:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1180 name: Gln->Phe def: "Gln->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1180] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1180" xref: delta_mono_mass "19.009836" xref: delta_avge_mass "19.0446" xref: delta_composition "H C(4) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:41:04" xref: date_time_modified "2011-06-21 17:41:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1181 name: Gln->Gly def: "Gln->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1181] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1181" xref: delta_mono_mass "-71.037114" xref: delta_avge_mass "-71.0779" xref: delta_composition "H(-5) C(-3) N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:41:24" xref: date_time_modified "2011-06-21 17:41:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1182 name: Gln->Met def: "Gln->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1182] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1182" xref: delta_mono_mass "2.981907" xref: delta_avge_mass "3.0668" xref: delta_composition "H N(-1) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:41:53" xref: date_time_modified "2011-06-21 17:41:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1183 name: Gln->Asn def: "Gln->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1183] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1183" xref: delta_mono_mass "-14.01565" xref: delta_avge_mass "-14.0266" xref: delta_composition "H(-2) C(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:42:17" xref: date_time_modified "2011-06-21 17:42:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1184 name: Gln->Ser def: "Gln->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1184] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1184" xref: delta_mono_mass "-41.026549" xref: delta_avge_mass "-41.0519" xref: delta_composition "H(-3) C(-2) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:42:37" xref: date_time_modified "2011-06-21 17:42:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1185 name: Gln->Thr def: "Gln->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1185] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1185" xref: delta_mono_mass "-27.010899" xref: delta_avge_mass "-27.0253" xref: delta_composition "H(-1) C(-1) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:42:58" xref: date_time_modified "2011-06-21 17:42:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1186 name: Gln->Val def: "Gln->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1186] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1186" xref: delta_mono_mass "-28.990164" xref: delta_avge_mass "-28.9982" xref: delta_composition "H N(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:43:20" xref: date_time_modified "2011-06-21 17:43:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1187 name: Gln->Trp def: "Gln->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1187] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1187" xref: delta_mono_mass "58.020735" xref: delta_avge_mass "58.0807" xref: delta_composition "H(2) C(6) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:43:42" xref: date_time_modified "2011-06-21 17:43:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1188 name: Gln->Tyr def: "Gln->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1188] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1188" xref: delta_mono_mass "35.004751" xref: delta_avge_mass "35.044" xref: delta_composition "H C(4) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-21 17:44:02" xref: date_time_modified "2011-06-21 17:44:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1189 name: Arg->Ala def: "Arg->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1189] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1189" xref: delta_mono_mass "-85.063997" xref: delta_avge_mass "-85.1078" xref: delta_composition "H(-7) C(-3) N(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:47:36" xref: date_time_modified "2011-06-23 10:47:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1190 name: Arg->Asp def: "Arg->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1190] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1190" xref: delta_mono_mass "-41.074168" xref: delta_avge_mass "-41.0983" xref: delta_composition "H(-7) C(-2) N(-3) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:48:03" xref: date_time_modified "2011-06-23 10:48:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1191 name: Arg->Glu def: "Arg->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1191] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1191" xref: delta_mono_mass "-27.058518" xref: delta_avge_mass "-27.0717" xref: delta_composition "H(-5) C(-1) N(-3) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:48:51" xref: date_time_modified "2011-06-23 10:48:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1192 name: Arg->Asn def: "Arg->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1192] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1192" xref: delta_mono_mass "-42.058184" xref: delta_avge_mass "-42.083" xref: delta_composition "H(-6) C(-2) N(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:49:09" xref: date_time_modified "2011-06-23 10:49:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1193 name: Arg->Val def: "Arg->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1193] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1193" xref: delta_mono_mass "-57.032697" xref: delta_avge_mass "-57.0546" xref: delta_composition "H(-3) C(-1) N(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:49:53" xref: date_time_modified "2011-06-23 10:49:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1194 name: Arg->Tyr def: "Arg->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1194] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1194" xref: delta_mono_mass "6.962218" xref: delta_avge_mass "6.9876" xref: delta_composition "H(-3) C(3) N(-3) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:50:15" xref: date_time_modified "2011-06-23 10:50:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1195 name: Arg->Phe def: "Arg->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1195] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1195" xref: delta_mono_mass "-9.032697" xref: delta_avge_mass "-9.0118" xref: delta_composition "H(-3) C(3) N(-3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:55:03" xref: date_time_modified "2011-06-23 10:55:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1196 name: Ser->Asp def: "Ser->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1196] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1196" xref: delta_mono_mass "27.994915" xref: delta_avge_mass "28.0101" xref: delta_composition "C O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:57:45" xref: date_time_modified "2011-06-23 10:57:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1197 name: Ser->Glu def: "Ser->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1197] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1197" xref: delta_mono_mass "42.010565" xref: delta_avge_mass "42.0367" xref: delta_composition "H(2) C(2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:58:11" xref: date_time_modified "2011-06-23 10:58:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1198 name: Ser->His def: "Ser->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1198] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1198" xref: delta_mono_mass "50.026883" xref: delta_avge_mass "50.062" xref: delta_composition "H(2) C(3) N(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:58:34" xref: date_time_modified "2011-06-23 10:58:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1199 name: Ser->Lys def: "Ser->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1199] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1199" xref: delta_mono_mass "41.062935" xref: delta_avge_mass "41.095" xref: delta_composition "H(7) C(3) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:58:58" xref: date_time_modified "2011-06-23 10:58:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1200 name: Ser->Met def: "Ser->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1200] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1200" xref: delta_mono_mass "44.008456" xref: delta_avge_mass "44.1188" xref: delta_composition "H(4) C(2) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:59:19" xref: date_time_modified "2011-06-23 10:59:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1201 name: Ser->Gln def: "Ser->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1201] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1201" xref: delta_mono_mass "41.026549" xref: delta_avge_mass "41.0519" xref: delta_composition "H(3) C(2) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:59:38" xref: date_time_modified "2011-06-23 10:59:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1202 name: Ser->Val def: "Ser->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1202] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1202" xref: delta_mono_mass "12.036386" xref: delta_avge_mass "12.0538" xref: delta_composition "H(4) C(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 10:59:59" xref: date_time_modified "2011-06-23 10:59:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1203 name: Thr->Cys def: "Thr->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1203] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1203" xref: delta_mono_mass "1.961506" xref: delta_avge_mass "2.039" xref: delta_composition "H(-2) C(-1) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:00:56" xref: date_time_modified "2011-06-23 11:00:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1204 name: Thr->Asp def: "Thr->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1204] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1204" xref: delta_mono_mass "13.979265" xref: delta_avge_mass "13.9835" xref: delta_composition "H(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:01:35" xref: date_time_modified "2011-06-23 11:01:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1205 name: Thr->Glu def: "Thr->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1205] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1205" xref: delta_mono_mass "27.994915" xref: delta_avge_mass "28.0101" xref: delta_composition "C O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:02:00" xref: date_time_modified "2011-06-23 11:02:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1206 name: Thr->Phe def: "Thr->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1206] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1206" xref: delta_mono_mass "46.020735" xref: delta_avge_mass "46.07" xref: delta_composition "H(2) C(5) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:02:21" xref: date_time_modified "2011-06-23 11:02:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1207 name: Thr->Gly def: "Thr->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1207] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1207" xref: delta_mono_mass "-44.026215" xref: delta_avge_mass "-44.0526" xref: delta_composition "H(-4) C(-2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:02:41" xref: date_time_modified "2011-06-23 11:02:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1208 name: Thr->His def: "Thr->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1208] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1208" xref: delta_mono_mass "36.011233" xref: delta_avge_mass "36.0354" xref: delta_composition "C(2) N(2) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:03:03" xref: date_time_modified "2011-06-23 11:03:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1209 name: Thr->Gln def: "Thr->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1209] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1209" xref: delta_mono_mass "27.010899" xref: delta_avge_mass "27.0253" xref: delta_composition "H C N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:03:26" xref: date_time_modified "2011-06-23 11:03:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1210 name: Thr->Val def: "Thr->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1210] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1210" xref: delta_mono_mass "-1.979265" xref: delta_avge_mass "-1.9728" xref: delta_composition "H(2) C O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:03:48" xref: date_time_modified "2011-06-23 11:03:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1211 name: Thr->Trp def: "Thr->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1211] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1211" xref: delta_mono_mass "85.031634" xref: delta_avge_mass "85.106" xref: delta_composition "H(3) C(7) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:04:08" xref: date_time_modified "2011-06-23 11:04:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1212 name: Thr->Tyr def: "Thr->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1212] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1212" xref: delta_mono_mass "62.01565" xref: delta_avge_mass "62.0694" xref: delta_composition "H(2) C(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:04:28" xref: date_time_modified "2011-06-23 11:04:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1213 name: Val->Cys def: "Val->Cys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1213] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1213" xref: delta_mono_mass "3.940771" xref: delta_avge_mass "4.0118" xref: delta_composition "H(-4) C(-2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:19:57" xref: date_time_modified "2011-06-23 11:19:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1214 name: Val->His def: "Val->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1214] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1214" xref: delta_mono_mass "37.990498" xref: delta_avge_mass "38.0082" xref: delta_composition "H(-2) C N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:20:23" xref: date_time_modified "2011-06-23 11:20:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1215 name: Val->Lys def: "Val->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1215] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1215" xref: delta_mono_mass "29.026549" xref: delta_avge_mass "29.0412" xref: delta_composition "H(3) C N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:20:45" xref: date_time_modified "2011-06-23 11:20:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1216 name: Val->Asn def: "Val->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1216] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1216" xref: delta_mono_mass "14.974514" xref: delta_avge_mass "14.9716" xref: delta_composition "H(-3) C(-1) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:21:04" xref: date_time_modified "2011-06-23 11:21:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1217 name: Val->Pro def: "Val->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1217] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1217" xref: delta_mono_mass "-2.01565" xref: delta_avge_mass "-2.0159" xref: delta_composition "H(-2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:21:23" xref: date_time_modified "2011-06-23 11:21:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1218 name: Val->Gln def: "Val->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1218] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1218" xref: delta_mono_mass "28.990164" xref: delta_avge_mass "28.9982" xref: delta_composition "H(-1) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:21:42" xref: date_time_modified "2011-06-23 11:21:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1219 name: Val->Arg def: "Val->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1219] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1219" xref: delta_mono_mass "57.032697" xref: delta_avge_mass "57.0546" xref: delta_composition "H(3) C N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:22:05" xref: date_time_modified "2011-06-23 11:22:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1220 name: Val->Ser def: "Val->Ser substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1220] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1220" xref: delta_mono_mass "-12.036386" xref: delta_avge_mass "-12.0538" xref: delta_composition "H(-4) C(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:22:26" xref: date_time_modified "2011-06-23 11:22:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1221 name: Val->Thr def: "Val->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1221] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1221" xref: delta_mono_mass "1.979265" xref: delta_avge_mass "1.9728" xref: delta_composition "H(-2) C(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:22:49" xref: date_time_modified "2011-06-23 11:22:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1222 name: Val->Trp def: "Val->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1222] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1222" xref: delta_mono_mass "87.010899" xref: delta_avge_mass "87.0788" xref: delta_composition "H C(6) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:23:11" xref: date_time_modified "2011-06-23 11:23:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1223 name: Val->Tyr def: "Val->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1223] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1223" xref: delta_mono_mass "63.994915" xref: delta_avge_mass "64.0422" xref: delta_composition "C(4) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:23:33" xref: date_time_modified "2011-06-23 11:23:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "V" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1224 name: Trp->Ala def: "Trp->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1224] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1224" xref: delta_mono_mass "-115.042199" xref: delta_avge_mass "-115.132" xref: delta_composition "H(-5) C(-8) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:39:07" xref: date_time_modified "2011-06-23 11:39:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1225 name: Trp->Asp def: "Trp->Asp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1225] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1225" xref: delta_mono_mass "-71.05237" xref: delta_avge_mass "-71.1225" xref: delta_composition "H(-5) C(-7) N(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:40:26" xref: date_time_modified "2011-06-23 11:40:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1226 name: Trp->Glu def: "Trp->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1226] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1226" xref: delta_mono_mass "-57.03672" xref: delta_avge_mass "-57.0959" xref: delta_composition "H(-3) C(-6) N(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:40:48" xref: date_time_modified "2011-06-23 11:40:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1227 name: Trp->Phe def: "Trp->Phe substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1227] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1227" xref: delta_mono_mass "-39.010899" xref: delta_avge_mass "-39.036" xref: delta_composition "H(-1) C(-2) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:41:09" xref: date_time_modified "2011-06-23 11:41:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1228 name: Trp->His def: "Trp->His substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1228] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1228" xref: delta_mono_mass "-49.020401" xref: delta_avge_mass "-49.0706" xref: delta_composition "H(-3) C(-5) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:41:32" xref: date_time_modified "2011-06-23 11:41:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1229 name: Trp->Lys def: "Trp->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1229] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1229" xref: delta_mono_mass "-57.98435" xref: delta_avge_mass "-58.0376" xref: delta_composition "H(2) C(-5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:41:52" xref: date_time_modified "2011-06-23 11:41:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1230 name: Trp->Met def: "Trp->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1230] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1230" xref: delta_mono_mass "-55.038828" xref: delta_avge_mass "-55.0138" xref: delta_composition "H(-1) C(-6) N(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:42:11" xref: date_time_modified "2011-06-23 11:42:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1231 name: Trp->Asn def: "Trp->Asn substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1231] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1231" xref: delta_mono_mass "-72.036386" xref: delta_avge_mass "-72.1073" xref: delta_composition "H(-4) C(-7) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:42:32" xref: date_time_modified "2011-06-23 11:42:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1232 name: Trp->Pro def: "Trp->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1232] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1232" xref: delta_mono_mass "-89.026549" xref: delta_avge_mass "-89.0947" xref: delta_composition "H(-3) C(-6) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:42:53" xref: date_time_modified "2011-06-23 11:42:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1233 name: Trp->Gln def: "Trp->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1233] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1233" xref: delta_mono_mass "-58.020735" xref: delta_avge_mass "-58.0807" xref: delta_composition "H(-2) C(-6) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:43:14" xref: date_time_modified "2011-06-23 11:43:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1234 name: Trp->Thr def: "Trp->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1234] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1234" xref: delta_mono_mass "-85.031634" xref: delta_avge_mass "-85.106" xref: delta_composition "H(-3) C(-7) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:43:34" xref: date_time_modified "2011-06-23 11:43:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1235 name: Trp->Val def: "Trp->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1235] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1235" xref: delta_mono_mass "-87.010899" xref: delta_avge_mass "-87.0788" xref: delta_composition "H(-1) C(-6) N(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:43:54" xref: date_time_modified "2011-06-23 11:43:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1236 name: Trp->Tyr def: "Trp->Tyr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1236] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1236" xref: delta_mono_mass "-23.015984" xref: delta_avge_mass "-23.0366" xref: delta_composition "H(-1) C(-2) N(-1) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:44:18" xref: date_time_modified "2011-06-23 11:44:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1237 name: Tyr->Ala def: "Tyr->Ala substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1237] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1237" xref: delta_mono_mass "-92.026215" xref: delta_avge_mass "-92.0954" xref: delta_composition "H(-4) C(-6) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:46:23" xref: date_time_modified "2011-06-23 11:46:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1238 name: Tyr->Glu def: "Tyr->Glu substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1238] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1238" xref: delta_mono_mass "-34.020735" xref: delta_avge_mass "-34.0593" xref: delta_composition "H(-2) C(-4) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:46:45" xref: date_time_modified "2011-06-23 11:46:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1239 name: Tyr->Gly def: "Tyr->Gly substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1239] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1239" xref: delta_mono_mass "-106.041865" xref: delta_avge_mass "-106.1219" xref: delta_composition "H(-6) C(-7) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:47:05" xref: date_time_modified "2011-06-23 11:47:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1240 name: Tyr->Lys def: "Tyr->Lys substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1240] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1240" xref: delta_mono_mass "-34.968366" xref: delta_avge_mass "-35.001" xref: delta_composition "H(3) C(-3) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:47:23" xref: date_time_modified "2011-06-23 11:47:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1241 name: Tyr->Met def: "Tyr->Met substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1241] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1241" xref: delta_mono_mass "-32.022844" xref: delta_avge_mass "-31.9772" xref: delta_composition "C(-4) O(-1) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:47:43" xref: date_time_modified "2011-06-23 11:47:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1242 name: Tyr->Pro def: "Tyr->Pro substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1242] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1242" xref: delta_mono_mass "-66.010565" xref: delta_avge_mass "-66.0581" xref: delta_composition "H(-2) C(-4) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:48:07" xref: date_time_modified "2011-06-23 11:48:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1243 name: Tyr->Gln def: "Tyr->Gln substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1243] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1243" xref: delta_mono_mass "-35.004751" xref: delta_avge_mass "-35.044" xref: delta_composition "H(-1) C(-4) N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:48:28" xref: date_time_modified "2011-06-23 11:48:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1244 name: Tyr->Arg def: "Tyr->Arg substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1244] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1244" xref: delta_mono_mass "-6.962218" xref: delta_avge_mass "-6.9876" xref: delta_composition "H(3) C(-3) N(3) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:48:49" xref: date_time_modified "2011-06-23 11:48:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1245 name: Tyr->Thr def: "Tyr->Thr substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1245] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1245" xref: delta_mono_mass "-62.01565" xref: delta_avge_mass "-62.0694" xref: delta_composition "H(-2) C(-5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:49:10" xref: date_time_modified "2011-06-23 11:49:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1246 name: Tyr->Val def: "Tyr->Val substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1246] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1246" xref: delta_mono_mass "-63.994915" xref: delta_avge_mass "-64.0422" xref: delta_composition "C(-4) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:49:30" xref: date_time_modified "2011-06-23 11:49:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1247 name: Tyr->Trp def: "Tyr->Trp substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1247] synonym: "Misacylation of the tRNA or editing of the charged tRNA" [] xref: record_id "1247" xref: delta_mono_mass "23.015984" xref: delta_avge_mass "23.0366" xref: delta_composition "H C(2) N O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:49:50" xref: date_time_modified "2011-06-23 11:49:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1248 name: Tyr->Xle def: "Tyr->Leu/Ile substitution." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1248] xref: record_id "1248" xref: delta_mono_mass "-49.979265" xref: delta_avge_mass "-50.0156" xref: delta_composition "H(2) C(-3) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-06-23 11:53:26" xref: date_time_modified "2011-06-23 11:53:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "AA substitution" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1249 name: AHA-SS def: "Azidohomoalanine coupled to reductively cleaved tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1249] xref: record_id "1249" xref: delta_mono_mass "195.075625" xref: delta_avge_mass "195.1787" xref: delta_composition "H(9) C(7) N(5) O(2)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-06-24 10:58:26" xref: date_time_modified "2011-06-27 17:38:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1250 name: AHA-SS_CAM def: "Carbamidomethylated form of reductively cleaved tag coupled to azidohomoalanine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1250] xref: record_id "1250" xref: delta_mono_mass "252.097088" xref: delta_avge_mass "252.23" xref: delta_composition "H(12) C(9) N(6) O(3)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-06-24 11:00:11" xref: date_time_modified "2011-06-27 17:39:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Multiple" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1251 name: Biotin:Thermo-33033 def: "Sulfo-SBED Label Photoreactive Biotin Crosslinker." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1251] xref: record_id "1251" xref: delta_mono_mass "548.223945" xref: delta_avge_mass "548.7211" xref: delta_composition "H(36) C(25) N(6) O(4) S(2)" xref: username_of_poster "Magnojunqueira" xref: group_of_poster "" xref: date_time_posted "2011-06-24 16:58:05" xref: date_time_modified "2013-04-16 23:21:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Sulfo-SBED Label Transfer ReagentrnReaction path that does not remove one Hidrogen atom from the target peptide" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1252 name: Biotin:Thermo-33033-H def: "Sulfo-SBED Label Photoreactive Biotin Crosslinker minus Hydrogen." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1252] xref: record_id "1252" xref: delta_mono_mass "546.208295" xref: delta_avge_mass "546.7053" xref: delta_composition "H(34) C(25) N(6) O(4) S(2)" xref: username_of_poster "Magnojunqueira" xref: group_of_poster "" xref: date_time_posted "2011-06-24 17:01:13" xref: date_time_modified "2011-06-24 21:16:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Sulfo-SBED Label Transfer Reagent. Reaction path that removes one Hydrogen atom from the target peptide" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1253 name: 2-monomethylsuccinyl def: "S-(2-monomethylsuccinyl) cysteine." [URL:http\://www.chemblink.com/products/2756-87-8.htm, PMID:http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=5369209, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1253] xref: record_id "1253" xref: delta_mono_mass "130.026609" xref: delta_avge_mass "130.0987" xref: delta_composition "H(6) C(5) O(4)" xref: username_of_poster "JMcGouran" xref: group_of_poster "" xref: date_time_posted "2011-06-28 15:27:43" xref: date_time_modified "2011-07-12 14:25:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1254 name: Saligenin def: "O-toluene." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1254] comment: Believed to be created in a secondary reaction after initial formation of an adduct between the organophosphate 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one and Tyr or Ser in proteins. xref: record_id "1254" xref: delta_mono_mass "106.041865" xref: delta_avge_mass "106.1219" xref: delta_composition "H(6) C(7) O" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2011-06-30 19:24:11" xref: date_time_modified "2011-07-09 09:17:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1255 name: Cresylphosphate def: "O-toluyl-phosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1255] comment: Created by hydrolysis of the product of the reaction of 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one with amino acids residues in proteins. xref: record_id "1255" xref: delta_mono_mass "170.013281" xref: delta_avge_mass "170.1024" xref: delta_composition "H(7) C(7) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2011-06-30 19:33:14" xref: date_time_modified "2011-07-09 09:20:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1256 name: CresylSaligeninPhosphate def: "Cresyl-Saligenin-phosphorylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1256] comment: Created by reaction of 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one with amino acid residues in proteins. xref: record_id "1256" xref: delta_mono_mass "276.055146" xref: delta_avge_mass "276.2244" xref: delta_composition "H(13) C(14) O(4) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2011-06-30 19:38:15" xref: date_time_modified "2011-07-09 09:21:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1257 name: Ub-Br2 def: "Ub Bromide probe addition." [URL:http\://www.enzolifesciences.com/fileadmin/reports/els_0a605e18ec.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1257] synonym: "Active site DUB cystine modification with Br Ub probe Trypsin Digestion reminant of Ub Br probe" [] xref: record_id "1257" xref: delta_mono_mass "100.063663" xref: delta_avge_mass "100.1191" xref: delta_composition "H(8) C(4) N(2) O" xref: username_of_poster "JMcGouran" xref: group_of_poster "" xref: date_time_posted "2011-07-01 13:25:05" xref: date_time_modified "2011-07-11 11:30:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1258 name: Ub-VME def: "Ubiquitin vinylmethylester." [URL:http\://www.lifesensors.com/pdf/Ub-VME_datasheet.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1258] synonym: "Active site DUB cystine modification with VME Ub probe Trypsin Digestion reminant of Ub VMEr probe" [] xref: record_id "1258" xref: delta_mono_mass "173.092617" xref: delta_avge_mass "173.1897" xref: delta_composition "H(13) C(7) N(2) O(3)" xref: username_of_poster "JMcGouran" xref: group_of_poster "" xref: date_time_posted "2011-07-01 13:27:56" xref: date_time_modified "2011-07-11 11:26:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1260 name: Ub-amide def: "Ub amide probe addition." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1260] comment: Unpublished chemically synthesized protein modification tool. synonym: "Active site DUB cystine modification with Ub amide probe Trypsin Digestion reminant of Ub amide probe" [] xref: record_id "1260" xref: delta_mono_mass "196.108602" xref: delta_avge_mass "196.2264" xref: delta_composition "H(14) C(9) N(3) O(2)" xref: username_of_poster "JMcGouran" xref: group_of_poster "" xref: date_time_posted "2011-07-01 13:47:40" xref: date_time_modified "2011-07-12 14:28:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1261 name: Ub-fluorescein def: "Ub Fluorescein probe addition." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1261] comment: Unpublished chemically synthesized protein modification tool. synonym: "Active site DUB cystine modification with Fluorescein Ub probe Trypsin Digestion reminant of Ub Fluorescein probe" [] xref: record_id "1261" xref: delta_mono_mass "597.209772" xref: delta_avge_mass "597.598" xref: delta_composition "H(29) C(31) N(6) O(7)" xref: username_of_poster "JMcGouran" xref: group_of_poster "" xref: date_time_posted "2011-07-01 13:49:56" xref: date_time_modified "2011-07-12 14:28:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1262 name: 2-dimethylsuccinyl def: "S-(2-dimethylsuccinyl) cysteine." [PMID:http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=637568&loc=ec_rcs, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1262] xref: record_id "1262" xref: delta_mono_mass "144.042259" xref: delta_avge_mass "144.1253" xref: delta_composition "H(8) C(6) O(4)" xref: username_of_poster "JMcGouran" xref: group_of_poster "" xref: date_time_posted "2011-07-06 10:55:02" xref: date_time_modified "2011-07-12 14:25:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1263 name: Gly def: "Addition of Glycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1263] comment: Occasionally used as chemical tag. In most cases, +57 is actually over-alkylation with iodoacetamide. xref: record_id "1263" xref: delta_mono_mass "57.021464" xref: delta_avge_mass "57.0513" xref: delta_composition "H(3) C(2) N O" xref: username_of_poster "kstampe2" xref: group_of_poster "" xref: date_time_posted "2011-07-07 16:37:10" xref: date_time_modified "2020-10-05 09:16:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1264 name: pupylation def: "Addition of GGE." [PMID:21738222, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1264] xref: record_id "1264" xref: delta_mono_mass "243.085521" xref: delta_avge_mass "243.2166" xref: delta_composition "H(13) C(9) N(3) O(5)" xref: username_of_poster "hbromage" xref: group_of_poster "" xref: date_time_posted "2011-07-13 21:34:29" xref: date_time_modified "2011-07-24 12:24:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1266 name: Label:13C(4) def: "13C4 Methionine label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1266] synonym: "SILAC" [] xref: record_id "1266" xref: delta_mono_mass "4.013419" xref: delta_avge_mass "3.9706" xref: delta_composition "C(-4) 13C(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-07-27 09:55:40" xref: date_time_modified "2011-12-07 10:49:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1267 name: Label:13C(4)+Oxidation def: "Oxidised 13C4 labelled Methionine." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1267] synonym: "SILAC" [] xref: record_id "1267" xref: delta_mono_mass "20.008334" xref: delta_avge_mass "19.97" xref: delta_composition "C(-4) 13C(4) O" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-07-27 10:10:30" xref: date_time_modified "2011-08-05 14:17:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1270 name: HCysThiolactone def: "N-Homocysteine thiolactone." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1270] xref: record_id "1270" xref: delta_mono_mass "117.024835" xref: delta_avge_mass "117.1695" xref: delta_composition "H(7) C(4) N O S" xref: username_of_poster "alejandro" xref: group_of_poster "" xref: date_time_posted "2011-09-15 19:31:10" xref: date_time_modified "2014-12-01 10:35:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "N-Homocysteine thiolactone is an acylating agent and can react with the E amino group of lysine residues" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1271 name: HCysteinyl def: "S-homocysteinylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1271] xref: record_id "1271" xref: delta_mono_mass "133.019749" xref: delta_avge_mass "133.1689" xref: delta_composition "H(7) C(4) N O(2) S" xref: username_of_poster "alejandro" xref: group_of_poster "" xref: date_time_posted "2011-09-15 19:36:44" xref: date_time_modified "2011-09-23 16:33:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_1_misc_notes "Homocysteine can take part in disulfide exchange reactions with S-S bonds in proteins, thus forming S-homocysteinylated proteins" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1276 name: UgiJoullie def: "Side reaction of HisTag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1276] comment: Side product of the three component Ugi-Joullie reaction. Pirrolidine is reacted with a isocianide modificated peptide (CNGGHHHHHH) to get a Pro-Gly-GGHHHHHH. The main product is the C-terminal modified protein. Unlikely Asp and Glu can react. xref: record_id "1276" xref: delta_mono_mass "1106.48935" xref: delta_avge_mass "1107.1274" xref: delta_composition "H(60) C(47) N(23) O(10)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-09-26 12:42:53" xref: date_time_modified "2011-09-30 12:38:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1277 name: Dipyridyl def: "Cys modified with dipy ligand." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1277] comment: Cysteine residue reacts with a chlorinated dipyridyl ligand to get a monoalkylated Cys-L1. The only product is this single cys mutant modified on that position. xref: record_id "1277" xref: delta_mono_mass "225.090212" xref: delta_avge_mass "225.2459" xref: delta_composition "H(11) C(13) N(3) O" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-09-27 18:33:34" xref: date_time_modified "2012-01-20 14:46:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1278 name: Furan def: "Chemical modification of the iodinated sites of thyroglobulin by Suzuki reaction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1278] xref: record_id "1278" xref: delta_mono_mass "66.010565" xref: delta_avge_mass "66.0581" xref: delta_composition "H(2) C(4) O" xref: username_of_poster "chem0303" xref: group_of_poster "" xref: date_time_posted "2011-09-28 13:31:35" xref: date_time_modified "2011-09-30 12:39:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1279 name: Difuran def: "Chemical modification of the diiodinated sites of thyroglobulin by Suzuki reaction." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1279] xref: record_id "1279" xref: delta_mono_mass "132.021129" xref: delta_avge_mass "132.1162" xref: delta_composition "H(4) C(8) O(2)" xref: username_of_poster "chem0303" xref: group_of_poster "" xref: date_time_posted "2011-09-28 13:34:45" xref: date_time_modified "2011-09-30 12:40:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1281 name: BMP-piperidinol def: "1-methyl-3-benzoyl-4-hydroxy-4-phenylpiperidine." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1281] synonym: "(4-hydroxy-1-methyl-4-phenylpiperidin-3-yl)(phenyl)methanone 3-benzoyl-1-methyl-4-phenyl-4-piperidinol" [] xref: record_id "1281" xref: delta_mono_mass "263.131014" xref: delta_avge_mass "263.3337" xref: delta_composition "H(17) C(18) N O" xref: username_of_poster "Areej" xref: group_of_poster "" xref: date_time_posted "2011-10-12 12:22:26" xref: date_time_modified "2012-01-13 15:44:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1282 name: UgiJoullieProGly def: "Side reaction of PG with Side chain of aspartic or glutamic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1282] comment: Side product of the three component Ugi-Joullie reaction. Pirrolidine is reacted with a isocianide modificated glycine to get Protein-Pro-Gly. The main product is the C-terminal modified protein. Unlikely Asp and Glu can react. xref: record_id "1282" xref: delta_mono_mass "154.074228" xref: delta_avge_mass "154.1665" xref: delta_composition "H(10) C(7) N(2) O(2)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-10-14 18:11:28" xref: date_time_modified "2011-10-21 16:41:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1283 name: UgiJoullieProGlyProGly def: "Side reaction of PGPG with Side chain of aspartic or glutamic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1283] comment: Side product of the three component Ugi-Joullie reaction. Pirrolidine is reacted with a isocianide modificated glycine to get Protein-Pro-Gly-Pro-Gly. The main product is the C-terminal modified protein. Unlikely Asp and Glu can react. xref: record_id "1283" xref: delta_mono_mass "308.148455" xref: delta_avge_mass "308.333" xref: delta_composition "H(20) C(14) N(4) O(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-10-14 18:14:19" xref: date_time_modified "2011-10-21 16:40:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1286 name: IMEHex(2)NeuAc(1) def: "Glycosylation with IME linked Hex(2) NeuAc." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1286] comment: Modification by Hex(2) NeuAc using IME coupling to get glycosylated proteins. synonym: "(2-Imino-2-methoxyethyl 1-thioglycoside)" [] xref: record_id "1286" xref: delta_mono_mass "688.199683" xref: delta_avge_mass "688.6527" xref: delta_composition "H(3) C(2) N S Hex(2) NeuAc" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2011-11-11 12:06:36" xref: date_time_modified "2015-05-01 14:20:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1287 name: Arg-loss def: "Loss of arginine due to transpeptidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1287] xref: record_id "1287" xref: delta_mono_mass "-156.101111" xref: delta_avge_mass "-156.1857" xref: delta_composition "H(-12) C(-6) N(-4) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 10:12:18" xref: date_time_modified "2011-11-24 16:39:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Any C-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1288 name: Arg def: "Addition of arginine due to transpeptidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1288] xref: record_id "1288" xref: delta_mono_mass "156.101111" xref: delta_avge_mass "156.1857" xref: delta_composition "H(12) C(6) N(4) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 10:15:00" xref: date_time_modified "2011-11-21 10:17:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1289 name: Butyryl def: "Butyryl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1289] xref: record_id "1289" xref: delta_mono_mass "70.041865" xref: delta_avge_mass "70.0898" xref: delta_composition "H(6) C(4) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 12:06:20" xref: date_time_modified "2011-11-21 12:06:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1290 name: Dicarbamidomethyl def: "Double Carbamidomethylation." [PMID:18511913, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1290] comment: Mentioned by Marshall Bern. xref: record_id "1290" xref: delta_mono_mass "114.042927" xref: delta_avge_mass "114.1026" xref: delta_composition "H(6) C(4) N(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 13:21:06" xref: date_time_modified "2013-05-16 10:59:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "R" xref: spec_4_position "Anywhere" xref: spec_4_classification "Artefact" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "N-term" xref: spec_5_position "Any N-term" xref: spec_5_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1291 name: Dimethyl:2H(6) def: "Dimethyl-Medium." [PMID:15782174, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1291] xref: record_id "1291" xref: delta_mono_mass "34.068961" xref: delta_avge_mass "34.0901" xref: delta_composition "H(-2) 2H(6) C(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 13:27:00" xref: date_time_modified "2013-02-22 12:32:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1292 name: GGQ def: "SUMOylation leaving GlyGlyGln." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1292] xref: record_id "1292" xref: delta_mono_mass "242.101505" xref: delta_avge_mass "242.2319" xref: delta_composition "H(14) C(9) N(4) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 13:37:45" xref: date_time_modified "2011-11-21 13:53:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1293 name: QTGG def: "SUMOylation leaving GlnThrGlyGly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1293] xref: record_id "1293" xref: delta_mono_mass "343.149184" xref: delta_avge_mass "343.3357" xref: delta_composition "H(21) C(13) N(5) O(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 13:41:32" xref: date_time_modified "2011-11-25 13:05:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "This peptide is generated from a trypsin/chymotrypsin dual digest." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1296 name: Label:13C(3) def: "13C3 label for SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1296] xref: record_id "1296" xref: delta_mono_mass "3.010064" xref: delta_avge_mass "2.978" xref: delta_composition "C(-3) 13C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 14:36:18" xref: date_time_modified "2011-11-21 14:37:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1297 name: Label:13C(3)15N(1) def: "SILAC or AQUA label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, URL:https\://www.thermofisher.com/order/catalog/product/A40010#/A40010, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1297] xref: record_id "1297" xref: delta_mono_mass "4.007099" xref: delta_avge_mass "3.9714" xref: delta_composition "C(-3) 13C(3) N(-1) 15N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 14:37:53" xref: date_time_modified "2020-01-09 09:44:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1298 name: Label:13C(4)15N(1) def: "13C4 15N1 label for SILAC." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1298] xref: record_id "1298" xref: delta_mono_mass "5.010454" xref: delta_avge_mass "4.964" xref: delta_composition "C(-4) 13C(4) N(-1) 15N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 14:40:56" xref: date_time_modified "2011-11-21 14:40:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1299 name: Label:2H(10) def: "2H(10) label." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1299] xref: record_id "1299" xref: delta_mono_mass "10.062767" xref: delta_avge_mass "10.0616" xref: delta_composition "H(-10) 2H(10)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 14:51:01" xref: date_time_modified "2011-11-21 14:51:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "L" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1300 name: Label:2H(4)13C(1) def: "Label:2H(4)13C(1)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1300] comment: For SILAC experiments. xref: record_id "1300" xref: delta_mono_mass "5.028462" xref: delta_avge_mass "5.0173" xref: delta_composition "H(-4) 2H(4) C(-1) 13C" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 14:52:54" xref: date_time_modified "2011-11-21 14:52:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1301 name: Lys def: "Addition of lysine due to transpeptidation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1301] xref: record_id "1301" xref: delta_mono_mass "128.094963" xref: delta_avge_mass "128.1723" xref: delta_composition "H(12) C(6) N(2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-21 14:56:07" xref: date_time_modified "2015-05-06 12:07:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1302 name: mTRAQ:13C(6)15N(2) def: "MTRAQ heavy." [URL:http\://www3.appliedbiosystems.com/cms/groups/psm_support/documents/generaldocuments/cms_054141.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1302] synonym: "Applied Biosystems mTRAQ(TM) reagent" [] xref: record_id "1302" xref: delta_mono_mass "148.109162" xref: delta_avge_mass "148.1257" xref: delta_composition "H(12) C 13C(6) 15N(2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-25 10:35:32" xref: date_time_modified "2011-11-25 10:35:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "0" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Very low abundance" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_5_misc_notes "Very low abundance" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" xref: spec_6_misc_notes "Very low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1303 name: NeuAc def: "N-acetyl neuraminic acid." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1303] xref: record_id "1303" xref: delta_mono_mass "291.095417" xref: delta_avge_mass "291.2546" xref: delta_composition "NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-25 10:40:54" xref: date_time_modified "2015-05-01 15:11:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_292_mono_mass "291.095417" xref: spec_1_neutral_loss_292_avge_mass "291.2546" xref: spec_1_neutral_loss_292_flag "false" xref: spec_1_neutral_loss_292_composition "NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_292_mono_mass "291.095417" xref: spec_2_neutral_loss_292_avge_mass "291.2546" xref: spec_2_neutral_loss_292_flag "false" xref: spec_2_neutral_loss_292_composition "NeuAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_292_mono_mass "291.095417" xref: spec_2_neutral_loss_292_avge_mass "291.2546" xref: spec_2_neutral_loss_292_flag "false" xref: spec_2_neutral_loss_292_composition "NeuAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1304 name: NeuGc def: "N-glycoyl neuraminic acid." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1304] xref: record_id "1304" xref: delta_mono_mass "307.090331" xref: delta_avge_mass "307.254" xref: delta_composition "NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-25 10:41:35" xref: date_time_modified "2015-05-01 15:13:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_308_mono_mass "307.090331" xref: spec_1_neutral_loss_308_avge_mass "307.254" xref: spec_1_neutral_loss_308_flag "false" xref: spec_1_neutral_loss_308_composition "NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_308_mono_mass "307.090331" xref: spec_2_neutral_loss_308_avge_mass "307.254" xref: spec_2_neutral_loss_308_flag "false" xref: spec_2_neutral_loss_308_composition "NeuGc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_308_mono_mass "307.090331" xref: spec_2_neutral_loss_308_avge_mass "307.254" xref: spec_2_neutral_loss_308_flag "false" xref: spec_2_neutral_loss_308_composition "NeuGc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1305 name: Propyl def: "Propyl." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1305] xref: record_id "1305" xref: delta_mono_mass "42.04695" xref: delta_avge_mass "42.0797" xref: delta_composition "H(6) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-25 11:06:09" xref: date_time_modified "2014-10-17 11:31:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "D" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_3_misc_notes "propyl ester" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "E" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_4_misc_notes "propyl ester" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "C-term" xref: spec_5_position "Any C-term" xref: spec_5_classification "Chemical derivative" xref: spec_5_misc_notes "propyl ester" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "C-term" xref: spec_6_position "Protein C-term" xref: spec_6_classification "Chemical derivative" xref: spec_6_misc_notes "propyl ester" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1306 name: Propyl:2H(6) def: "Propyl:2H(6)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1306] xref: record_id "1306" xref: delta_mono_mass "48.084611" xref: delta_avge_mass "48.1167" xref: delta_composition "2H(6) C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2011-11-25 11:06:56" xref: date_time_modified "2011-11-25 11:06:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1310 name: Propiophenone def: "Propiophenone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1310] xref: record_id "1310" xref: delta_mono_mass "132.057515" xref: delta_avge_mass "132.1592" xref: delta_composition "H(8) C(9) O" xref: username_of_poster "Areej" xref: group_of_poster "" xref: date_time_posted "2011-12-07 23:43:34" xref: date_time_modified "2011-12-09 13:50:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "W" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "C" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1312 name: Delta:H(6)C(3)O(1) def: "Reduced acrolein addition +58." [PMID:21778411, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1312] xref: record_id "1312" xref: delta_mono_mass "58.041865" xref: delta_avge_mass "58.0791" xref: delta_composition "H(6) C(3) O" xref: username_of_poster "yiyingzhu" xref: group_of_poster "" xref: date_time_posted "2011-12-15 19:38:31" xref: date_time_modified "2011-12-16 15:11:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Protein N-term" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1313 name: Delta:H(8)C(6)O(1) def: "Reduced acrolein addition +96." [PMID:21778411, PMID:9632657, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1313] xref: record_id "1313" xref: delta_mono_mass "96.057515" xref: delta_avge_mass "96.1271" xref: delta_composition "H(8) C(6) O" xref: username_of_poster "yiyingzhu" xref: group_of_poster "" xref: date_time_posted "2011-12-15 19:48:15" xref: date_time_modified "2015-10-12 16:16:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1314 name: biotinAcrolein298 def: "Biotin hydrazide labeled acrolein addition +298." [PMID:21704744, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1314] xref: record_id "1314" xref: delta_mono_mass "298.146347" xref: delta_avge_mass "298.4044" xref: delta_composition "H(22) C(13) N(4) O(2) S" xref: username_of_poster "yiyingzhu" xref: group_of_poster "" xref: date_time_posted "2011-12-15 19:54:52" xref: date_time_modified "2011-12-16 15:19:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "N-term" xref: spec_4_position "Protein N-term" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1315 name: MM-diphenylpentanone def: "3-methyl-5-(methylamino)-1,3-diphenylpentan-1-one." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1315] xref: record_id "1315" xref: delta_mono_mass "265.146664" xref: delta_avge_mass "265.3496" xref: delta_composition "H(19) C(18) N O" xref: username_of_poster "Areej" xref: group_of_poster "" xref: date_time_posted "2011-12-21 21:29:00" xref: date_time_modified "2011-12-21 21:29:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1317 name: EHD-diphenylpentanone def: "2-ethyl-3-hydroxy-1,3-diphenylpentan-1-one." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/11869872, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1317] synonym: "3-benzoyl-1-methyl-4-phenyl-4-piperidinol demethyl damino" [] xref: record_id "1317" xref: delta_mono_mass "266.13068" xref: delta_avge_mass "266.3343" xref: delta_composition "H(18) C(18) O(2)" xref: username_of_poster "Areej" xref: group_of_poster "" xref: date_time_posted "2012-01-08 15:22:49" xref: date_time_modified "2012-01-13 15:41:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "M" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1320 name: Biotin:Thermo-21901+2H2O def: "Maleimide-Biotin + 2Water." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1320] synonym: "Maleimide-PEG2-Biotin + 2Water" [] xref: record_id "1320" xref: delta_mono_mass "561.246849" xref: delta_avge_mass "561.6489" xref: delta_composition "H(39) C(23) N(5) O(9) S" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2012-01-23 14:20:11" xref: date_time_modified "2012-01-27 12:51:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1321 name: DiLeu4plex115 def: "Accurate mass for DiLeu 115 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1321] comment: Different channels have the same nominal mass but slightly different exact masses. xref: record_id "1321" xref: delta_mono_mass "145.12" xref: delta_avge_mass "145.1966" xref: delta_composition "H(15) C(7) 13C 15N 18O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2012-02-15 12:05:08" xref: date_time_modified "2012-02-15 12:05:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1322 name: DiLeu4plex def: "Accurate mass for DiLeu 116 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1322] comment: Different channels have the same nominal mass but slightly different exact masses. synonym: "Representative, nominal mass for all four tags" [] xref: record_id "1322" xref: delta_mono_mass "145.132163" xref: delta_avge_mass "145.2229" xref: delta_composition "H(13) 2H(2) C(8) N 18O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2012-02-15 12:05:48" xref: date_time_modified "2016-09-22 15:14:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1323 name: DiLeu4plex117 def: "Accurate mass for DiLeu 117 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1323] comment: Different channels have the same nominal mass but slightly different exact masses. xref: record_id "1323" xref: delta_mono_mass "145.128307" xref: delta_avge_mass "145.2092" xref: delta_composition "H(13) 2H(2) C(7) 13C 15N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2012-02-15 12:06:10" xref: date_time_modified "2012-02-15 12:06:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1324 name: DiLeu4plex118 def: "Accurate mass for DiLeu 118 isobaric tag." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1324] comment: Different channels have the same nominal mass but slightly different exact masses. xref: record_id "1324" xref: delta_mono_mass "145.140471" xref: delta_avge_mass "145.2354" xref: delta_composition "H(11) 2H(4) C(8) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2012-02-15 12:06:30" xref: date_time_modified "2012-02-15 12:06:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Isotopic label" xref: spec_3_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1326 name: NEMsulfur def: "N-ethylmaleimideSulfur." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1326] synonym: "NEMS" [] xref: record_id "1326" xref: delta_mono_mass "157.019749" xref: delta_avge_mass "157.1903" xref: delta_composition "H(7) C(6) N O(2) S" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2012-02-29 17:06:24" xref: date_time_modified "2012-03-09 11:26:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1327 name: SulfurDioxide def: "SulfurDioxide." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/21740851, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1327] xref: record_id "1327" xref: delta_mono_mass "63.9619" xref: delta_avge_mass "64.0638" xref: delta_composition "O(2) S" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2012-02-29 17:24:24" xref: date_time_modified "2012-03-09 11:25:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1328 name: NEMsulfurWater def: "N-ethylmaleimideSulfurWater." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1328] synonym: "NEMSwater" [] xref: record_id "1328" xref: delta_mono_mass "175.030314" xref: delta_avge_mass "175.2056" xref: delta_composition "H(9) C(6) N O(3) S" xref: username_of_poster "Raghothama" xref: group_of_poster "" xref: date_time_posted "2012-02-29 17:25:30" xref: date_time_modified "2012-03-09 11:24:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1330 name: bisANS-sulfonates def: "BisANS with loss of both sulfonates." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1330] xref: record_id "1330" xref: delta_mono_mass "437.201774" xref: delta_avge_mass "437.5543" xref: delta_composition "H(25) C(32) N(2)" xref: username_of_poster "app95d" xref: group_of_poster "" xref: date_time_posted "2012-05-22 21:55:58" xref: date_time_modified "2012-05-29 12:07:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1331 name: DNCB_hapten def: "Chemical reaction with 2,4-dinitro-1-chloro benzene (DNCB)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1331] comment: Chemical reaction with 2,4-dinitro-1-chloro benzene (DNCB) by nucleophilic attack on electrophilic amino acid side chains. xref: record_id "1331" xref: delta_mono_mass "166.001457" xref: delta_avge_mass "166.0911" xref: delta_composition "H(2) C(6) N(2) O(4)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2012-05-24 13:55:30" xref: date_time_modified "2012-08-03 09:19:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1340 name: Biotin:Thermo-21911 def: "Biotin-PEG11-maleimide." [URL:http\://www.piercenet.com/browse.cfm?fldID=E3862D31-9A5C-4F0A-9879-F600D33BD926, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1340] synonym: "Thermo #21911" [] xref: record_id "1340" xref: delta_mono_mass "921.461652" xref: delta_avge_mass "922.0913" xref: delta_composition "H(71) C(41) N(5) O(16) S" xref: username_of_poster "Jolein_Gloerich" xref: group_of_poster "" xref: date_time_posted "2012-06-26 17:49:31" xref: date_time_modified "2012-07-14 19:02:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1341 name: iodoTMT def: "Native iodoacetyl Tandem Mass Tag®." [URL:http\://www.lifetechnologies.com/order/catalog/product/90100, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1341] comment: This modification describes the native iodoTMT Reagent without isotopic label. Upon CID, this reagent releases a reporter ion of 126.127725(monoisotopic mass). synonym: "iodoTMTzero iodoTMT0 Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] xref: record_id "1341" xref: delta_mono_mass "324.216141" xref: delta_avge_mass "324.4185" xref: delta_composition "H(28) C(16) N(4) O(3)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2012-07-06 17:37:43" xref: date_time_modified "2015-04-20 16:12:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "K" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1342 name: iodoTMT6plex def: "Sixplex iodoacetyl Tandem Mass Tag®." [URL:http\://www.lifetechnologies.com/order/catalog/product/90102, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1342] comment: This modification describes the native iodoTMT Reagent without isotopic label. Upon CID, this reagent releases a reporter ions of 126.127725, 127.124760, 128.134433, 129.131468, 130.141141, and 131.138176 (monoisotopic mass). synonym: "iodoTMTsixplex iodoTMT6 Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc." [] xref: record_id "1342" xref: delta_mono_mass "329.226595" xref: delta_avge_mass "329.3825" xref: delta_composition "H(28) C(12) 13C(4) N(3) 15N O(3)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2012-07-06 17:43:59" xref: date_time_modified "2015-04-20 16:13:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "D" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "E" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "K" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1344 name: Phosphogluconoylation def: "Phosphogluconoylation." [URL:http\://www.abrf.org/index.cfm/dm.details?DMID=275&AvgMass=258&Margin=0, PMID:18083862, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1344] xref: record_id "1344" xref: delta_mono_mass "258.014069" xref: delta_avge_mass "258.1199" xref: delta_composition "H(11) C(6) O(9) P" xref: username_of_poster "gwadams" xref: group_of_poster "" xref: date_time_posted "2012-07-13 14:40:15" xref: date_time_modified "2013-05-22 10:55:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1345 name: PS_Hapten def: "Reaction with phenyl salicylate (PS)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1345] xref: record_id "1345" xref: delta_mono_mass "120.021129" xref: delta_avge_mass "120.1055" xref: delta_composition "H(4) C(7) O(2)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2012-08-01 14:45:32" xref: date_time_modified "2012-08-03 09:20:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1348 name: Cy3-maleimide def: "Cy3 Maleimide mono-Reactive dye." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1348] synonym: "Cy3 mono-functional maleimides are used for the selective labeling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides." [] xref: record_id "1348" xref: delta_mono_mass "753.262796" xref: delta_avge_mass "753.9046" xref: delta_composition "H(45) C(37) N(4) O(9) S(2)" xref: username_of_poster "hbromage" xref: group_of_poster "" xref: date_time_posted "2012-08-27 21:50:06" xref: date_time_modified "2015-01-02 09:46:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1349 name: benzylguanidine def: "Modification of the lysine side chain from NH2 to guanidine with a H removed in favor of a benzyl group." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1349] synonym: "adds 132 Da to K side chain" [] xref: record_id "1349" xref: delta_mono_mass "132.068748" xref: delta_avge_mass "132.1625" xref: delta_composition "H(8) C(8) N(2)" xref: username_of_poster "pepinr" xref: group_of_poster "" xref: date_time_posted "2012-09-06 17:14:04" xref: date_time_modified "2012-09-07 15:15:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1350 name: CarboxymethylDMAP def: "A fixed +1 charge tag attached to the N-terminus of peptides." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1350] synonym: "Added mass is reduced by 1 H to reflect that first charge state requires no proton addition Replaces one of the N-terminal H atoms with C9H12N2O" [] xref: record_id "1350" xref: delta_mono_mass "162.079313" xref: delta_avge_mass "162.1885" xref: delta_composition "H(10) C(9) N(2) O" xref: username_of_poster "pepinr" xref: group_of_poster "" xref: date_time_posted "2012-09-06 17:32:42" xref: date_time_modified "2012-09-07 15:19:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1355 name: azole def: "Formation of five membered aromatic heterocycle." [PMID:15883371, PMID:8895467, PMID:10200165, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1355] xref: record_id "1355" xref: delta_mono_mass "-20.026215" xref: delta_avge_mass "-20.0312" xref: delta_composition "H(-4) O(-1)" xref: username_of_poster "jomcintosh" xref: group_of_poster "" xref: date_time_posted "2012-09-10 17:32:20" xref: date_time_modified "2012-09-15 00:33:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1356 name: phosphoRibosyl def: "Phosphate-ribosylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1356] xref: record_id "1356" xref: delta_mono_mass "212.00859" xref: delta_avge_mass "212.0945" xref: delta_composition "H(9) C(5) O(7) P" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2012-09-19 14:16:08" xref: date_time_modified "2015-04-29 11:15:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "R" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1358 name: NEM:2H(5)+H2O def: "D5 N-ethylmaleimide+water on cysteines." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1358] comment: Lab based observation that D5 NEM hydrolyses in an analogous way to NEM. synonym: "CysNEM D5 hydrolised" [] xref: record_id "1358" xref: delta_mono_mass "148.089627" xref: delta_avge_mass "148.1714" xref: delta_composition "H(4) 2H(5) C(6) N O(3)" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2012-10-16 17:45:04" xref: date_time_modified "2012-11-02 16:22:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1363 name: Crotonyl def: "Crotonylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1363] xref: record_id "1363" xref: delta_mono_mass "68.026215" xref: delta_avge_mass "68.074" xref: delta_composition "H(4) C(4) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2012-12-24 15:50:10" xref: date_time_modified "2017-10-09 15:45:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1364 name: O-Et-N-diMePhospho def: "O-ethyl, N-dimethyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1364] comment: Adduct formed upon reaction of the organophosphate tabun with the active site serine of serine esterases/proteases such as butyrylcholinestease. synonym: "tabun" [] xref: record_id "1364" xref: delta_mono_mass "135.044916" xref: delta_avge_mass "135.1015" xref: delta_composition "H(10) C(4) N O(2) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2013-01-27 13:26:33" xref: date_time_modified "2013-02-07 16:50:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1365 name: N-dimethylphosphate def: "N-dimethylphosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1365] comment: This adduct is a consequence of hydrolysis of the initial adduct formed by tabun (aging) on the active site serine of serine esterases/proteases such as butyrylcholinesterase. synonym: "aged tabun" [] xref: record_id "1365" xref: delta_mono_mass "107.013615" xref: delta_avge_mass "107.0483" xref: delta_composition "H(6) C(2) N O(2) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2013-01-27 13:36:32" xref: date_time_modified "2013-02-07 16:49:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1367 name: dHex(1)Hex(1) def: "Hex1dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1367] xref: record_id "1367" xref: delta_mono_mass "308.110732" xref: delta_avge_mass "308.2818" xref: delta_composition "dHex Hex" xref: username_of_poster "dfplazag" xref: group_of_poster "" xref: date_time_posted "2013-02-07 14:29:21" xref: date_time_modified "2015-05-01 15:14:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_309_mono_mass "308.110732" xref: spec_1_neutral_loss_309_avge_mass "308.2818" xref: spec_1_neutral_loss_309_flag "false" xref: spec_1_neutral_loss_309_composition "dHex Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_309_mono_mass "308.110732" xref: spec_1_neutral_loss_309_avge_mass "308.2818" xref: spec_1_neutral_loss_309_flag "false" xref: spec_1_neutral_loss_309_composition "dHex Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1368 name: Methyl:2H(3)+Acetyl:2H(3) def: "3-fold methylated lysine labelled with Acetyl_heavy." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1368] xref: record_id "1368" xref: delta_mono_mass "62.063875" xref: delta_avge_mass "62.1002" xref: delta_composition "H(-2) 2H(6) C(3) O" xref: username_of_poster "Plank" xref: group_of_poster "" xref: date_time_posted "2013-02-14 16:21:54" xref: date_time_modified "2013-02-14 16:21:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1370 name: Label:2H(3)+Oxidation def: "Oxidised 2H(3) labelled Methionine." [URL:http\://www.pil.sdu.dk/silac_intro.htm, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1370] synonym: "SILAC" [] xref: record_id "1370" xref: delta_mono_mass "19.013745" xref: delta_avge_mass "19.0179" xref: delta_composition "H(-3) 2H(3) O" xref: username_of_poster "Plank" xref: group_of_poster "" xref: date_time_posted "2013-02-14 16:36:56" xref: date_time_modified "2013-02-22 12:39:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1371 name: Trimethyl:2H(9) def: "3-fold methylation with deuterated methyl groups." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1371] xref: record_id "1371" xref: delta_mono_mass "51.103441" xref: delta_avge_mass "51.1352" xref: delta_composition "H(-3) 2H(9) C(3)" xref: username_of_poster "Plank" xref: group_of_poster "" xref: date_time_posted "2013-02-14 17:14:16" xref: date_time_modified "2013-02-22 12:37:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1372 name: Acetyl:13C(2) def: "Heavy acetylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1372] xref: record_id "1372" xref: delta_mono_mass "44.017274" xref: delta_avge_mass "44.022" xref: delta_composition "H(2) 13C(2) O" xref: username_of_poster "Plank" xref: group_of_poster "" xref: date_time_posted "2013-02-14 17:24:23" xref: date_time_modified "2013-02-14 17:24:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1375 name: dHex(1)Hex(2) def: "Hex2dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1375] xref: record_id "1375" xref: delta_mono_mass "470.163556" xref: delta_avge_mass "470.4224" xref: delta_composition "dHex Hex(2)" xref: username_of_poster "dfplazag" xref: group_of_poster "" xref: date_time_posted "2013-04-10 14:57:30" xref: date_time_modified "2015-05-01 15:18:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_471_mono_mass "470.163556" xref: spec_1_neutral_loss_471_avge_mass "470.4224" xref: spec_1_neutral_loss_471_flag "false" xref: spec_1_neutral_loss_471_composition "dHex Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_471_mono_mass "470.163556" xref: spec_1_neutral_loss_471_avge_mass "470.4224" xref: spec_1_neutral_loss_471_flag "false" xref: spec_1_neutral_loss_471_composition "dHex Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1376 name: dHex(1)Hex(3) def: "Hex3dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1376] xref: record_id "1376" xref: delta_mono_mass "632.216379" xref: delta_avge_mass "632.563" xref: delta_composition "dHex Hex(3)" xref: username_of_poster "dfplazag" xref: group_of_poster "" xref: date_time_posted "2013-04-10 15:00:23" xref: date_time_modified "2015-05-01 15:24:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_633_mono_mass "632.216379" xref: spec_1_neutral_loss_633_avge_mass "632.563" xref: spec_1_neutral_loss_633_flag "false" xref: spec_1_neutral_loss_633_composition "dHex Hex(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_633_mono_mass "632.216379" xref: spec_1_neutral_loss_633_avge_mass "632.563" xref: spec_1_neutral_loss_633_flag "false" xref: spec_1_neutral_loss_633_composition "dHex Hex(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1377 name: dHex(1)Hex(4) def: "Hex4dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1377] xref: record_id "1377" xref: delta_mono_mass "794.269203" xref: delta_avge_mass "794.7036" xref: delta_composition "dHex Hex(4)" xref: username_of_poster "dfplazag" xref: group_of_poster "" xref: date_time_posted "2013-04-10 15:01:35" xref: date_time_modified "2015-05-01 15:27:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_795_mono_mass "794.269203" xref: spec_1_neutral_loss_795_avge_mass "794.7036" xref: spec_1_neutral_loss_795_flag "false" xref: spec_1_neutral_loss_795_composition "dHex Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_795_mono_mass "794.269203" xref: spec_1_neutral_loss_795_avge_mass "794.7036" xref: spec_1_neutral_loss_795_flag "false" xref: spec_1_neutral_loss_795_composition "dHex Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1378 name: dHex(1)Hex(5) def: "Hex5dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1378] xref: record_id "1378" xref: delta_mono_mass "956.322026" xref: delta_avge_mass "956.8442" xref: delta_composition "dHex Hex(5)" xref: username_of_poster "dfplazag" xref: group_of_poster "" xref: date_time_posted "2013-04-10 15:03:12" xref: date_time_modified "2015-05-01 15:43:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_957_mono_mass "956.322026" xref: spec_1_neutral_loss_957_avge_mass "956.8442" xref: spec_1_neutral_loss_957_flag "false" xref: spec_1_neutral_loss_957_composition "dHex Hex(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_957_mono_mass "956.322026" xref: spec_1_neutral_loss_957_avge_mass "956.8442" xref: spec_1_neutral_loss_957_flag "false" xref: spec_1_neutral_loss_957_composition "dHex Hex(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1379 name: dHex(1)Hex(6) def: "Hex6dHex1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1379] xref: record_id "1379" xref: delta_mono_mass "1118.37485" xref: delta_avge_mass "1118.9848" xref: delta_composition "dHex Hex(6)" xref: username_of_poster "dfplazag" xref: group_of_poster "" xref: date_time_posted "2013-04-10 15:04:22" xref: date_time_modified "2015-05-01 15:44:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1119_mono_mass "1118.37485" xref: spec_1_neutral_loss_1119_avge_mass "1118.9848" xref: spec_1_neutral_loss_1119_flag "false" xref: spec_1_neutral_loss_1119_composition "dHex Hex(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1119_mono_mass "1118.37485" xref: spec_1_neutral_loss_1119_avge_mass "1118.9848" xref: spec_1_neutral_loss_1119_flag "false" xref: spec_1_neutral_loss_1119_composition "dHex Hex(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1380 name: methylsulfonylethyl def: "Reaction with methyl vinyl sulfone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/?term=2475130, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1380] synonym: "protein alkylation by Michael acceptor methyl vinyl sulfone" [] xref: record_id "1380" xref: delta_mono_mass "106.00885" xref: delta_avge_mass "106.1435" xref: delta_composition "H(6) C(3) O(2) S" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2013-04-24 14:30:59" xref: date_time_modified "2013-05-02 10:13:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1381 name: ethylsulfonylethyl def: "Reaction with ethyl vinyl sulfone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/2475130, PMID:http://www.ncbi.nlm.nih.gov/pubmed/1242713, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1381] synonym: "protein alkylation by Michael acceptor ethyl vinyl sulfone" [] xref: record_id "1381" xref: delta_mono_mass "120.0245" xref: delta_avge_mass "120.1701" xref: delta_composition "H(8) C(4) O(2) S" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2013-04-24 14:36:48" xref: date_time_modified "2013-04-26 09:25:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1382 name: phenylsulfonylethyl def: "Reaction with phenyl vinyl sulfone." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/18528979, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1382] synonym: "protein alkylation by Michael acceptor phenyl vinyl sulfone" [] xref: record_id "1382" xref: delta_mono_mass "168.0245" xref: delta_avge_mass "168.2129" xref: delta_composition "H(8) C(8) O(2) S" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2013-04-24 14:41:29" xref: date_time_modified "2013-04-26 09:25:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1383 name: PyridoxalPhosphateH2 def: "PLP bound to lysine reduced by sodium borohydride (NaBH4) to create amine linkage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1383] synonym: "Pyridoxal Phosphate reduced" [] xref: record_id "1383" xref: delta_mono_mass "231.02966" xref: delta_avge_mass "231.1425" xref: delta_composition "H(10) C(8) N O(5) P" xref: username_of_poster "bphilmus" xref: group_of_poster "" xref: date_time_posted "2013-04-29 17:33:45" xref: date_time_modified "2013-05-03 17:30:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "This is a chemical derivatization of the PLP imine with sodium borohydride to reduce imine bound through lysine epsilon amine group to chemical stable amine linkage" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1384 name: Homocysteic_acid def: "Methionine oxidation to homocysteic acid." [PMID:20169556, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1384] xref: record_id "1384" xref: delta_mono_mass "33.969094" xref: delta_avge_mass "33.9716" xref: delta_composition "H(-2) C(-1) O(3)" xref: username_of_poster "mbern" xref: group_of_poster "" xref: date_time_posted "2013-05-16 20:08:11" xref: date_time_modified "2013-05-31 15:57:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1385 name: Hydroxamic_acid def: "ADP-ribosylation followed by conversion to hydroxamic acid via hydroxylamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1385] synonym: "Conversion of carboxylic acid to hydroxamic acid" [] xref: record_id "1385" xref: delta_mono_mass "15.010899" xref: delta_avge_mass "15.0146" xref: delta_composition "H N" xref: username_of_poster "mbern" xref: group_of_poster "" xref: date_time_posted "2013-05-16 20:40:47" xref: date_time_modified "2020-03-26 09:49:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "From exposure to hydroxylamine (used with TMT)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "From exposure to hydroxylamine (used with TMT)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1387 name: 3-phosphoglyceryl def: "3-phosphoglyceryl." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/?term=23908237, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1387] xref: record_id "1387" xref: delta_mono_mass "167.982375" xref: delta_avge_mass "168.042" xref: delta_composition "H(5) C(3) O(6) P" xref: username_of_poster "BThomas" xref: group_of_poster "" xref: date_time_posted "2013-08-05 10:54:22" xref: date_time_modified "2013-11-01 16:34:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1388 name: HN2_mustard def: "Modification by hydroxylated mechloroethamine (HN-2)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1388] xref: record_id "1388" xref: delta_mono_mass "101.084064" xref: delta_avge_mass "101.1469" xref: delta_composition "H(11) C(5) N O" xref: username_of_poster "vthompson" xref: group_of_poster "" xref: date_time_posted "2013-08-23 18:36:39" xref: date_time_modified "2013-09-23 11:42:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1389 name: HN3_mustard def: "Modification by hydroxylated tris-(2-chloroethyl)amine (HN-3)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1389] xref: record_id "1389" xref: delta_mono_mass "131.094629" xref: delta_avge_mass "131.1729" xref: delta_composition "H(13) C(6) N O(2)" xref: username_of_poster "vthompson" xref: group_of_poster "" xref: date_time_posted "2013-08-23 19:13:36" xref: date_time_modified "2013-09-23 11:42:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1390 name: Oxidation+NEM def: "N-ethylmaleimide on cysteine sulfenic acid." [PMID:24103186, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1390] xref: record_id "1390" xref: delta_mono_mass "141.042593" xref: delta_avge_mass "141.1247" xref: delta_composition "H(7) C(6) N O(3)" xref: username_of_poster "jheld" xref: group_of_poster "" xref: date_time_posted "2013-10-16 15:31:20" xref: date_time_modified "2013-11-01 16:37:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1391 name: NHS-fluorescein def: "Fluorescein-hexanoate-NHS hydrolysis." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1391] xref: record_id "1391" xref: delta_mono_mass "471.131802" xref: delta_avge_mass "471.4581" xref: delta_composition "H(21) C(27) N O(7)" xref: username_of_poster "cgadelha" xref: group_of_poster "" xref: date_time_posted "2013-10-18 12:14:19" xref: date_time_modified "2013-11-01 16:37:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1392 name: DiART6plex def: "Representative mass and accurate mass for 114." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1392] comment: Different tags have the same nominal mass but slightly different exact masses. Use this modification for all tags for quantitation purposes. Monoisotopic masses of the fragment ions to be quantified are 114.12827, 115.12531, 116.14082, 117.13786, 118.14752, 119.14456. synonym: "Isobaric labeling reagent from Omic Biosystems, Inc. AKA DiART6plex114" [] xref: record_id "1392" xref: delta_mono_mass "217.162932" xref: delta_avge_mass "217.2527" xref: delta_composition "H(20) C(7) 13C(4) N 15N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2013-11-06 11:18:58" xref: date_time_modified "2016-09-22 14:39:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1393 name: DiART6plex115 def: "Accurate mass for DiART6plex 115." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1393] comment: Different tags have the same nominal mass but slightly different exact masses. synonym: "Isobaric labeling reagent from Omic Biosystems, Inc." [] xref: record_id "1393" xref: delta_mono_mass "217.156612" xref: delta_avge_mass "217.2535" xref: delta_composition "H(20) C(8) 13C(3) 15N(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2013-11-06 11:34:33" xref: date_time_modified "2013-11-06 11:34:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1394 name: DiART6plex116/119 def: "Accurate mass for DiART6plex 116 and 119." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1394] comment: Different tags have the same nominal mass but slightly different exact masses. synonym: "Isobaric labeling reagent from Omic Biosystems, Inc." [] xref: record_id "1394" xref: delta_mono_mass "217.168776" xref: delta_avge_mass "217.2797" xref: delta_composition "H(18) 2H(2) C(9) 13C(2) N 15N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2013-11-06 11:35:52" xref: date_time_modified "2013-11-06 11:38:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1395 name: DiART6plex117 def: "Accurate mass for DiART6plex 117." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1395] comment: Different tags have the same nominal mass but slightly different exact masses. synonym: "Isobaric labeling reagent from Omic Biosystems, Inc." [] xref: record_id "1395" xref: delta_mono_mass "217.162456" xref: delta_avge_mass "217.2805" xref: delta_composition "H(18) 2H(2) C(10) 13C 15N(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2013-11-06 11:40:01" xref: date_time_modified "2013-11-06 11:40:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1396 name: DiART6plex118 def: "Accurate mass for DiART6plex 118." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1396] comment: Different tags have the same nominal mass but slightly different exact masses. synonym: "Isobaric labeling reagent from Omic Biosystems, Inc." [] xref: record_id "1396" xref: delta_mono_mass "217.175096" xref: delta_avge_mass "217.279" xref: delta_composition "H(18) 2H(2) C(8) 13C(3) N(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2013-11-06 11:40:58" xref: date_time_modified "2013-11-06 11:40:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_4_misc_notes "Low abundance" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1397 name: Iodoacetanilide def: "Iodoacetanilide derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1397] xref: record_id "1397" xref: delta_mono_mass "133.052764" xref: delta_avge_mass "133.1473" xref: delta_composition "H(7) C(8) N O" xref: username_of_poster "kcook123" xref: group_of_poster "" xref: date_time_posted "2013-12-10 04:26:07" xref: date_time_modified "2014-03-01 17:35:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1398 name: Iodoacetanilide:13C(6) def: "13C labelled iodoacetanilide derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1398] xref: record_id "1398" xref: delta_mono_mass "139.072893" xref: delta_avge_mass "139.1032" xref: delta_composition "H(7) C(2) 13C(6) N O" xref: username_of_poster "kcook123" xref: group_of_poster "" xref: date_time_posted "2013-12-10 04:31:00" xref: date_time_modified "2014-03-01 17:36:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1399 name: Dap-DSP def: "Diaminopimelic acid-DSP monolinked." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, URL:https\://www.ncbi.nlm.nih.gov/pubmed/?term=322714, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1399] comment: Addition of gram negative peptidoglycan amino acid (DAP) plus monolinked DSP. xref: record_id "1399" xref: delta_mono_mass "364.076278" xref: delta_avge_mass "364.4377" xref: delta_composition "H(20) C(13) N(2) O(6) S(2)" xref: username_of_poster "grigorios" xref: group_of_poster "" xref: date_time_posted "2014-02-20 11:23:24" xref: date_time_modified "2017-09-19 11:06:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "Non-standard residue" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Non-standard residue" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1400 name: MurNAc def: "N-Acetylmuramic acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1400] comment: Gram negative peptidoglycan saccharide amide bonded to Alanine. xref: record_id "1400" xref: delta_mono_mass "275.100502" xref: delta_avge_mass "275.2552" xref: delta_composition "O(-1) NeuAc" xref: username_of_poster "grigorios" xref: group_of_poster "" xref: date_time_posted "2014-02-20 12:47:46" xref: date_time_modified "2015-05-01 13:37:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other glycosylation" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1402 name: Label:2H(7)15N(4) def: "Label:2H(7)15N(4)." [URL:http\://shop.isotope.com/productdetails.aspx?id=10032309&itemno=DNLM-7543-PK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1402] comment: For SILAC experiments. synonym: "Cambridge Isotopes DNLM-7543-PK" [] xref: record_id "1402" xref: delta_mono_mass "11.032077" xref: delta_avge_mass "11.0168" xref: delta_composition "H(-7) 2H(7) N(-4) 15N(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-04-16 12:16:45" xref: date_time_modified "2014-04-16 12:16:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1403 name: Label:2H(6)15N(1) def: "Label:2H(6)15N(1)." [URL:http\://shop.isotope.com/productdetails.aspx?id=10032309&itemno=DNLM-7543-PK, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1403] comment: For SILAC experiments. synonym: "Arg-Pro conversion of Label:2H(7)15N(4)" [] xref: record_id "1403" xref: delta_mono_mass "7.034695" xref: delta_avge_mass "7.0304" xref: delta_composition "H(-6) 2H(6) N(-1) 15N" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-04-16 12:19:06" xref: date_time_modified "2014-04-16 12:19:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1405 name: EEEDVIEVYQEQTGG def: "Sumoylation by SUMO-1 after Cyanogen bromide (CNBr) cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1405] xref: record_id "1405" xref: delta_mono_mass "1705.73189" xref: delta_avge_mass "1706.7153" xref: delta_composition "H(107) C(72) N(17) O(31)" xref: username_of_poster "vogelw" xref: group_of_poster "" xref: date_time_posted "2014-06-25 15:15:44" xref: date_time_modified "2014-08-08 11:37:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1406 name: EDEDTIDVFQQQTGG def: "Sumoylation by SUMO-2/3 after Cyanogen bromide (CNBr) cleavage." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1406] xref: record_id "1406" xref: delta_mono_mass "1662.700924" xref: delta_avge_mass "1663.6508" xref: delta_composition "H(102) C(69) N(18) O(30)" xref: username_of_poster "vogelw" xref: group_of_poster "" xref: date_time_posted "2014-06-25 15:19:11" xref: date_time_modified "2014-08-08 11:37:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "The cleavage products of SUMO-2 and SUMO-3 are indistinguishable" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1408 name: Hex(5)HexNAc(4)NeuAc(2) def: "A2G2S2/G2S2." [URL:http\://www.unicarbkb.org/structure/1187, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1408] xref: record_id "1408" xref: delta_mono_mass "2204.772441" xref: delta_avge_mass "2205.9822" xref: delta_composition "Hex(5) HexNAc(4) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-07-31 13:51:41" xref: date_time_modified "2020-08-02 11:36:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_2205_mono_mass "2204.772441" xref: spec_1_neutral_loss_2205_avge_mass "2205.9822" xref: spec_1_neutral_loss_2205_flag "false" xref: spec_1_neutral_loss_2205_composition "Hex(5) HexNAc(4) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1409 name: Hex(5)HexNAc(4)NeuAc(1) def: "A2G2S1/G2S1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1409] xref: record_id "1409" xref: delta_mono_mass "1913.677025" xref: delta_avge_mass "1914.7277" xref: delta_composition "Hex(5) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-07-31 13:52:20" xref: date_time_modified "2020-08-02 11:37:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1914_mono_mass "1913.677025" xref: spec_1_neutral_loss_1914_avge_mass "1914.7277" xref: spec_1_neutral_loss_1914_flag "false" xref: spec_1_neutral_loss_1914_composition "Hex(5) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1410 name: dHex(1)Hex(5)HexNAc(4)NeuAc(1) def: "FA2G2S1/G2FS1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1410] xref: record_id "1410" xref: delta_mono_mass "2059.734933" xref: delta_avge_mass "2060.8689" xref: delta_composition "dHex Hex(5) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-07-31 13:53:31" xref: date_time_modified "2020-08-02 11:40:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_2060_mono_mass "2059.734933" xref: spec_1_neutral_loss_2060_avge_mass "2060.8689" xref: spec_1_neutral_loss_2060_flag "false" xref: spec_1_neutral_loss_2060_composition "dHex Hex(5) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1411 name: dHex(1)Hex(5)HexNAc(4)NeuAc(2) def: "FA2G2S2/G2FS2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1411] xref: record_id "1411" xref: delta_mono_mass "2350.83035" xref: delta_avge_mass "2352.1234" xref: delta_composition "dHex Hex(5) HexNAc(4) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-07-31 13:53:47" xref: date_time_modified "2020-08-02 11:40:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_2351_mono_mass "2350.83035" xref: spec_1_neutral_loss_2351_avge_mass "2352.1234" xref: spec_1_neutral_loss_2351_flag "false" xref: spec_1_neutral_loss_2351_composition "dHex Hex(5) HexNAc(4) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1412 name: s-GlcNAc def: "O3S1HexNAc1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1412] xref: record_id "1412" xref: delta_mono_mass "283.036187" xref: delta_avge_mass "283.2557" xref: delta_composition "O(3) S HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-08-14 15:34:42" xref: date_time_modified "2015-05-01 15:10:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_284_mono_mass "283.036187" xref: spec_1_neutral_loss_284_avge_mass "283.2557" xref: spec_1_neutral_loss_284_flag "false" xref: spec_1_neutral_loss_284_composition "O(3) S HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_284_mono_mass "283.036187" xref: spec_1_neutral_loss_284_avge_mass "283.2557" xref: spec_1_neutral_loss_284_flag "false" xref: spec_1_neutral_loss_284_composition "O(3) S HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1413 name: PhosphoHex(2) def: "H1O3P1Hex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1413] xref: record_id "1413" xref: delta_mono_mass "404.071978" xref: delta_avge_mass "404.2611" xref: delta_composition "H O(3) P Hex(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-08-14 15:38:35" xref: date_time_modified "2017-11-23 15:44:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_405_mono_mass "404.071978" xref: spec_1_neutral_loss_405_avge_mass "404.2611" xref: spec_1_neutral_loss_405_flag "false" xref: spec_1_neutral_loss_405_composition "H O(3) P Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_405_mono_mass "404.071978" xref: spec_1_neutral_loss_405_avge_mass "404.2611" xref: spec_1_neutral_loss_405_flag "false" xref: spec_1_neutral_loss_405_composition "H O(3) P Hex(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_misc_notes "Not reported for human proteins" xref: spec_2_neutral_loss_405_mono_mass "404.071978" xref: spec_2_neutral_loss_405_avge_mass "404.2611" xref: spec_2_neutral_loss_405_flag "false" xref: spec_2_neutral_loss_405_composition "H O(3) P Hex(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1414 name: Trimethyl:13C(3)2H(9) def: "3-fold methylation with fully labelled methyl groups." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1414] xref: record_id "1414" xref: delta_mono_mass "54.113505" xref: delta_avge_mass "54.1132" xref: delta_composition "H(-3) 2H(9) 13C(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2014-09-17 09:18:49" xref: date_time_modified "2014-09-17 09:18:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Anywhere" xref: spec_2_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1419 name: 15N-oxobutanoic def: "Loss of ammonia (15N)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1419] synonym: "pyruvic acid from N-term ser oxobutanoic acid from N term Thr" [] xref: record_id "1419" xref: delta_mono_mass "-18.023584" xref: delta_avge_mass "-18.0239" xref: delta_composition "H(-3) 15N(-1)" xref: username_of_poster "fufezan" xref: group_of_poster "" xref: date_time_posted "2014-11-24 13:24:53" xref: date_time_modified "2015-01-12 16:11:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "Pyro-carbamidomethyl as a delta from Carbamidomethyl-Cys" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1420 name: spermine def: "Spermine adduct." [URL:http\://dx.doi.org/10.1007/s00726-014-1879-8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1420] xref: record_id "1420" xref: delta_mono_mass "185.189198" xref: delta_avge_mass "185.3097" xref: delta_composition "H(23) C(10) N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-01-12 16:07:00" xref: date_time_modified "2015-01-12 16:07:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1421 name: spermidine def: "Spermidine adduct." [URL:http\://dx.doi.org/10.1007/s00726-014-1879-8, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1421] xref: record_id "1421" xref: delta_mono_mass "128.131349" xref: delta_avge_mass "128.2153" xref: delta_composition "H(16) C(7) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-01-12 16:08:04" xref: date_time_modified "2015-01-12 16:08:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1423 name: Biotin:Thermo-21330 def: "Biotin_PEG4." [URL:http\://www.lifetechnologies.com/order/catalog/product/21330, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1423] comment: Also available as 21329, 21362, 21363. synonym: "NHS-PEG4-Biotin" [] xref: record_id "1423" xref: delta_mono_mass "473.219571" xref: delta_avge_mass "473.5835" xref: delta_composition "H(35) C(21) N(3) O(7) S" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2015-04-20 16:08:05" xref: date_time_modified "2015-04-20 16:10:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1425 name: Pentose def: "Pentose." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1425] xref: record_id "1425" xref: delta_mono_mass "132.042259" xref: delta_avge_mass "132.1146" xref: delta_composition "Pent" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-01 17:01:09" xref: date_time_modified "2015-05-05 10:48:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_133_mono_mass "132.042259" xref: spec_1_neutral_loss_133_avge_mass "132.1146" xref: spec_1_neutral_loss_133_flag "false" xref: spec_1_neutral_loss_133_composition "Pent" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_133_mono_mass "132.042259" xref: spec_1_neutral_loss_133_avge_mass "132.1146" xref: spec_1_neutral_loss_133_flag "false" xref: spec_1_neutral_loss_133_composition "Pent" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1426 name: Hex(1)Pent(1) def: "Hex Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1426] xref: record_id "1426" xref: delta_mono_mass "294.095082" xref: delta_avge_mass "294.2552" xref: delta_composition "Pent Hex" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-01 17:03:00" xref: date_time_modified "2015-05-05 10:49:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_295_mono_mass "294.095082" xref: spec_1_neutral_loss_295_avge_mass "294.2552" xref: spec_1_neutral_loss_295_flag "false" xref: spec_1_neutral_loss_295_composition "Pent Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_295_mono_mass "294.095082" xref: spec_1_neutral_loss_295_avge_mass "294.2552" xref: spec_1_neutral_loss_295_flag "false" xref: spec_1_neutral_loss_295_composition "Pent Hex" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1427 name: Hex(1)HexA(1) def: "Hex HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1427] xref: record_id "1427" xref: delta_mono_mass "338.084912" xref: delta_avge_mass "338.2647" xref: delta_composition "Hex HexA" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-01 17:05:51" xref: date_time_modified "2015-05-05 10:49:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_339_mono_mass "338.084912" xref: spec_1_neutral_loss_339_avge_mass "338.2647" xref: spec_1_neutral_loss_339_flag "false" xref: spec_1_neutral_loss_339_composition "Hex HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_339_mono_mass "338.084912" xref: spec_1_neutral_loss_339_avge_mass "338.2647" xref: spec_1_neutral_loss_339_flag "false" xref: spec_1_neutral_loss_339_composition "Hex HexA" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1428 name: Hex(1)Pent(2) def: "Hex Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=2&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1428] xref: record_id "1428" xref: delta_mono_mass "426.137341" xref: delta_avge_mass "426.3698" xref: delta_composition "Pent(2) Hex" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:37:19" xref: date_time_modified "2015-05-05 10:50:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_427_mono_mass "426.137341" xref: spec_1_neutral_loss_427_avge_mass "426.3698" xref: spec_1_neutral_loss_427_flag "false" xref: spec_1_neutral_loss_427_composition "Pent(2) Hex" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_427_mono_mass "426.137341" xref: spec_1_neutral_loss_427_avge_mass "426.3698" xref: spec_1_neutral_loss_427_flag "false" xref: spec_1_neutral_loss_427_composition "Pent(2) Hex" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1429 name: Hex(1)HexNAc(1)Phos(1) def: "Hex HexNAc Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1429] xref: record_id "1429" xref: delta_mono_mass "445.098527" xref: delta_avge_mass "445.313" xref: delta_composition "H O(3) P Hex HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:40:49" xref: date_time_modified "2015-05-06 12:07:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_446_mono_mass "445.098527" xref: spec_1_neutral_loss_446_avge_mass "445.313" xref: spec_1_neutral_loss_446_flag "false" xref: spec_1_neutral_loss_446_composition "H O(3) P Hex HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_446_mono_mass "445.098527" xref: spec_1_neutral_loss_446_avge_mass "445.313" xref: spec_1_neutral_loss_446_flag "false" xref: spec_1_neutral_loss_446_composition "H O(3) P Hex HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1430 name: Hex(1)HexNAc(1)Sulf(1) def: "Hex HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1430] xref: record_id "1430" xref: delta_mono_mass "445.089011" xref: delta_avge_mass "445.3963" xref: delta_composition "O(3) S Hex HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:41:48" xref: date_time_modified "2015-05-06 12:07:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_446_mono_mass "445.089011" xref: spec_1_neutral_loss_446_avge_mass "445.3963" xref: spec_1_neutral_loss_446_flag "false" xref: spec_1_neutral_loss_446_composition "O(3) S Hex HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_446_mono_mass "445.089011" xref: spec_1_neutral_loss_446_avge_mass "445.3963" xref: spec_1_neutral_loss_446_flag "false" xref: spec_1_neutral_loss_446_composition "O(3) S Hex HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1431 name: Hex(1)NeuAc(1) def: "Hex NeuAc ---OR--- HexNAc Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1431] xref: record_id "1431" xref: delta_mono_mass "453.14824" xref: delta_avge_mass "453.3952" xref: delta_composition "Hex NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:45:11" xref: date_time_modified "2017-11-17 11:42:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_454_mono_mass "453.14824" xref: spec_1_neutral_loss_454_avge_mass "453.3952" xref: spec_1_neutral_loss_454_flag "false" xref: spec_1_neutral_loss_454_composition "Hex NeuAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_454_mono_mass "453.14824" xref: spec_1_neutral_loss_454_avge_mass "453.3952" xref: spec_1_neutral_loss_454_flag "false" xref: spec_1_neutral_loss_454_composition "Hex NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1432 name: Hex(1)NeuGc(1) def: "Hex NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1432] xref: record_id "1432" xref: delta_mono_mass "469.143155" xref: delta_avge_mass "469.3946" xref: delta_composition "Hex NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:45:57" xref: date_time_modified "2015-05-05 10:51:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_470_mono_mass "469.143155" xref: spec_1_neutral_loss_470_avge_mass "469.3946" xref: spec_1_neutral_loss_470_flag "false" xref: spec_1_neutral_loss_470_composition "Hex NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_470_mono_mass "469.143155" xref: spec_1_neutral_loss_470_avge_mass "469.3946" xref: spec_1_neutral_loss_470_flag "false" xref: spec_1_neutral_loss_470_composition "Hex NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1433 name: HexNAc(3) def: "HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1433] xref: record_id "1433" xref: delta_mono_mass "609.238118" xref: delta_avge_mass "609.5776" xref: delta_composition "HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:47:58" xref: date_time_modified "2015-05-06 12:09:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_610_mono_mass "609.238118" xref: spec_1_neutral_loss_610_avge_mass "609.5776" xref: spec_1_neutral_loss_610_flag "false" xref: spec_1_neutral_loss_610_composition "HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_610_mono_mass "609.238118" xref: spec_1_neutral_loss_610_avge_mass "609.5776" xref: spec_1_neutral_loss_610_flag "false" xref: spec_1_neutral_loss_610_composition "HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1434 name: HexNAc(1)NeuAc(1) def: "HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1434] xref: record_id "1434" xref: delta_mono_mass "494.174789" xref: delta_avge_mass "494.4471" xref: delta_composition "HexNAc NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:53:18" xref: date_time_modified "2015-05-05 10:52:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_495_mono_mass "494.174789" xref: spec_1_neutral_loss_495_avge_mass "494.4471" xref: spec_1_neutral_loss_495_flag "false" xref: spec_1_neutral_loss_495_composition "HexNAc NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_495_mono_mass "494.174789" xref: spec_1_neutral_loss_495_avge_mass "494.4471" xref: spec_1_neutral_loss_495_flag "false" xref: spec_1_neutral_loss_495_composition "HexNAc NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1435 name: HexNAc(1)NeuGc(1) def: "HexNAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1435] xref: record_id "1435" xref: delta_mono_mass "510.169704" xref: delta_avge_mass "510.4465" xref: delta_composition "HexNAc NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 09:54:16" xref: date_time_modified "2015-05-05 10:52:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_511_mono_mass "510.169704" xref: spec_1_neutral_loss_511_avge_mass "510.4465" xref: spec_1_neutral_loss_511_flag "false" xref: spec_1_neutral_loss_511_composition "HexNAc NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_511_mono_mass "510.169704" xref: spec_1_neutral_loss_511_avge_mass "510.4465" xref: spec_1_neutral_loss_511_flag "false" xref: spec_1_neutral_loss_511_composition "HexNAc NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1436 name: Hex(1)HexNAc(1)dHex(1)Me(1) def: "Hex HexNAc dHex Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&dhex=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1436] xref: record_id "1436" xref: delta_mono_mass "525.205755" xref: delta_avge_mass "525.5009" xref: delta_composition "Me dHex Hex HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:05:16" xref: date_time_modified "2015-05-06 12:08:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_526_mono_mass "525.205755" xref: spec_1_neutral_loss_526_avge_mass "525.5009" xref: spec_1_neutral_loss_526_flag "false" xref: spec_1_neutral_loss_526_composition "Me dHex Hex HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_526_mono_mass "525.205755" xref: spec_1_neutral_loss_526_avge_mass "525.5009" xref: spec_1_neutral_loss_526_flag "false" xref: spec_1_neutral_loss_526_composition "Me dHex Hex HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1437 name: Hex(1)HexNAc(1)dHex(1)Me(2) def: "Hex HexNAc dHex Me(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=2&dhex=1&hex=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1437] xref: record_id "1437" xref: delta_mono_mass "539.221405" xref: delta_avge_mass "539.5275" xref: delta_composition "Me(2) dHex Hex HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:06:28" xref: date_time_modified "2015-05-06 12:08:43" xref: approved "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_540_mono_mass "539.221405" xref: spec_2_neutral_loss_540_avge_mass "539.5275" xref: spec_2_neutral_loss_540_flag "false" xref: spec_2_neutral_loss_540_composition "Me(2) dHex Hex HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_540_mono_mass "539.221405" xref: spec_2_neutral_loss_540_avge_mass "539.5275" xref: spec_2_neutral_loss_540_flag "false" xref: spec_2_neutral_loss_540_composition "Me(2) dHex Hex HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1438 name: Hex(2)HexNAc(1) def: "Hex(2) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1438] xref: record_id "1438" xref: delta_mono_mass "527.18502" xref: delta_avge_mass "527.4737" xref: delta_composition "Hex(2) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:09:00" xref: date_time_modified "2017-11-23 16:36:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_528_mono_mass "527.18502" xref: spec_1_neutral_loss_528_avge_mass "527.4737" xref: spec_1_neutral_loss_528_flag "false" xref: spec_1_neutral_loss_528_composition "Hex(2) HexNAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_528_mono_mass "527.18502" xref: spec_1_neutral_loss_528_avge_mass "527.4737" xref: spec_1_neutral_loss_528_flag "false" xref: spec_1_neutral_loss_528_composition "Hex(2) HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_528_mono_mass "527.18502" xref: spec_2_neutral_loss_528_avge_mass "527.4737" xref: spec_2_neutral_loss_528_flag "false" xref: spec_2_neutral_loss_528_composition "Hex(2) HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1439 name: Hex(1)HexA(1)HexNAc(1) def: "Hex HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1439] xref: record_id "1439" xref: delta_mono_mass "541.164284" xref: delta_avge_mass "541.4572" xref: delta_composition "Hex HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:10:30" xref: date_time_modified "2015-05-05 10:55:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_542_mono_mass "541.164284" xref: spec_1_neutral_loss_542_avge_mass "541.4572" xref: spec_1_neutral_loss_542_flag "false" xref: spec_1_neutral_loss_542_composition "Hex HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_542_mono_mass "541.164284" xref: spec_1_neutral_loss_542_avge_mass "541.4572" xref: spec_1_neutral_loss_542_flag "false" xref: spec_1_neutral_loss_542_composition "Hex HexA HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1440 name: Hex(2)HexNAc(1)Me(1) def: "Hex(2) HexNAc Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1440] xref: record_id "1440" xref: delta_mono_mass "541.20067" xref: delta_avge_mass "541.5003" xref: delta_composition "Me Hex(2) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:12:19" xref: date_time_modified "2015-05-06 12:08:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_542_mono_mass "541.20067" xref: spec_1_neutral_loss_542_avge_mass "541.5003" xref: spec_1_neutral_loss_542_flag "false" xref: spec_1_neutral_loss_542_composition "Me Hex(2) HexNAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_542_mono_mass "541.20067" xref: spec_1_neutral_loss_542_avge_mass "541.5003" xref: spec_1_neutral_loss_542_flag "false" xref: spec_1_neutral_loss_542_composition "Me Hex(2) HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1441 name: Hex(1)Pent(3) def: "Hex Pent(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=3&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1441] xref: record_id "1441" xref: delta_mono_mass "558.1796" xref: delta_avge_mass "558.4845" xref: delta_composition "Pent(3) Hex" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:14:37" xref: date_time_modified "2017-11-23 16:39:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_559_mono_mass "558.1796" xref: spec_1_neutral_loss_559_avge_mass "558.4845" xref: spec_1_neutral_loss_559_flag "false" xref: spec_1_neutral_loss_559_composition "Pent(3) Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_559_mono_mass "558.1796" xref: spec_1_neutral_loss_559_avge_mass "558.4845" xref: spec_1_neutral_loss_559_flag "false" xref: spec_1_neutral_loss_559_composition "Pent(3) Hex" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1442 name: Hex(1)NeuAc(1)Pent(1) def: "Hex NeuAc Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1442] xref: record_id "1442" xref: delta_mono_mass "585.190499" xref: delta_avge_mass "585.5098" xref: delta_composition "Pent Hex NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 10:59:44" xref: date_time_modified "2015-05-05 10:59:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_586_mono_mass "585.190499" xref: spec_1_neutral_loss_586_avge_mass "585.5098" xref: spec_1_neutral_loss_586_flag "false" xref: spec_1_neutral_loss_586_composition "Pent Hex NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_586_mono_mass "585.190499" xref: spec_1_neutral_loss_586_avge_mass "585.5098" xref: spec_1_neutral_loss_586_flag "false" xref: spec_1_neutral_loss_586_composition "Pent Hex NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1443 name: Hex(2)HexNAc(1)Sulf(1) def: "Hex(2) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1443] xref: record_id "1443" xref: delta_mono_mass "607.141834" xref: delta_avge_mass "607.5369" xref: delta_composition "O(3) S Hex(2) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 11:01:43" xref: date_time_modified "2015-05-06 12:09:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_608_mono_mass "607.141834" xref: spec_1_neutral_loss_608_avge_mass "607.5369" xref: spec_1_neutral_loss_608_flag "false" xref: spec_1_neutral_loss_608_composition "O(3) S Hex(2) HexNAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_608_mono_mass "607.141834" xref: spec_1_neutral_loss_608_avge_mass "607.5369" xref: spec_1_neutral_loss_608_flag "false" xref: spec_1_neutral_loss_608_composition "O(3) S Hex(2) HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1444 name: Hex(2)NeuAc(1) def: "Hex(2) NeuAc ---OR--- Hex HexNAc Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1444] xref: record_id "1444" xref: delta_mono_mass "615.201064" xref: delta_avge_mass "615.5358" xref: delta_composition "Hex(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 11:04:03" xref: date_time_modified "2017-11-17 11:43:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_616_mono_mass "615.201064" xref: spec_1_neutral_loss_616_avge_mass "615.5358" xref: spec_1_neutral_loss_616_flag "false" xref: spec_1_neutral_loss_616_composition "Hex(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_616_mono_mass "615.201064" xref: spec_1_neutral_loss_616_avge_mass "615.5358" xref: spec_1_neutral_loss_616_flag "false" xref: spec_1_neutral_loss_616_composition "Hex(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1445 name: dHex(2)Hex(2) def: "Hex2 dHex2." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1445] xref: record_id "1445" xref: delta_mono_mass "616.221465" xref: delta_avge_mass "616.5636" xref: delta_composition "dHex(2) Hex(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 11:05:19" xref: date_time_modified "2015-05-05 11:05:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_617_mono_mass "616.221465" xref: spec_1_neutral_loss_617_avge_mass "616.5636" xref: spec_1_neutral_loss_617_flag "false" xref: spec_1_neutral_loss_617_composition "dHex(2) Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_617_mono_mass "616.221465" xref: spec_1_neutral_loss_617_avge_mass "616.5636" xref: spec_1_neutral_loss_617_flag "false" xref: spec_1_neutral_loss_617_composition "dHex(2) Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1446 name: dHex(1)Hex(2)HexA(1) def: "DHex Hex(2) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1446] xref: record_id "1446" xref: delta_mono_mass "646.195644" xref: delta_avge_mass "646.5465" xref: delta_composition "dHex Hex(2) HexA" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 11:06:47" xref: date_time_modified "2015-05-05 11:06:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_647_mono_mass "646.195644" xref: spec_1_neutral_loss_647_avge_mass "646.5465" xref: spec_1_neutral_loss_647_flag "false" xref: spec_1_neutral_loss_647_composition "dHex Hex(2) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_647_mono_mass "646.195644" xref: spec_1_neutral_loss_647_avge_mass "646.5465" xref: spec_1_neutral_loss_647_flag "false" xref: spec_1_neutral_loss_647_composition "dHex Hex(2) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1447 name: Hex(1)HexNAc(2)Sulf(1) def: "Hex HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1447] xref: record_id "1447" xref: delta_mono_mass "648.168383" xref: delta_avge_mass "648.5888" xref: delta_composition "O(3) S Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 11:09:57" xref: date_time_modified "2015-05-06 12:09:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_649_mono_mass "648.168383" xref: spec_1_neutral_loss_649_avge_mass "648.5888" xref: spec_1_neutral_loss_649_flag "false" xref: spec_1_neutral_loss_649_composition "O(3) S Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_649_mono_mass "648.168383" xref: spec_1_neutral_loss_649_avge_mass "648.5888" xref: spec_1_neutral_loss_649_flag "false" xref: spec_1_neutral_loss_649_composition "O(3) S Hex HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1448 name: Hex(4) def: "Hex(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1448] xref: record_id "1448" xref: delta_mono_mass "648.211294" xref: delta_avge_mass "648.5624" xref: delta_composition "Hex(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 11:10:47" xref: date_time_modified "2015-05-05 11:10:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_649_mono_mass "648.211294" xref: spec_1_neutral_loss_649_avge_mass "648.5624" xref: spec_1_neutral_loss_649_flag "false" xref: spec_1_neutral_loss_649_composition "Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_649_mono_mass "648.211294" xref: spec_1_neutral_loss_649_avge_mass "648.5624" xref: spec_1_neutral_loss_649_flag "false" xref: spec_1_neutral_loss_649_composition "Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1449 name: dHex(1)Hex(2)HexNAc(2)Pent(1) def: "DHex Hex(2) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1449] xref: record_id "1449" xref: delta_mono_mass "1008.36456" xref: delta_avge_mass "1008.9221" xref: delta_composition "dHex(1) Hex(2) HexNAc(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1009_mono_mass "1008.36456" xref: spec_1_neutral_loss_1009_avge_mass "1008.9221" xref: spec_1_neutral_loss_1009_flag "false" xref: spec_1_neutral_loss_1009_composition "dHex(1) Hex(2) HexNAc(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1450 name: Hex(2)HexNAc(2)NeuAc(1) def: "Hex(2) HexNAc(2) NeuAc ---OR--- dHex Hex HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1450] xref: record_id "1450" xref: delta_mono_mass "1021.359809" xref: delta_avge_mass "1021.9208" xref: delta_composition "Hex(2) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 11:53:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1022_mono_mass "1021.359809" xref: spec_1_neutral_loss_1022_avge_mass "1021.9208" xref: spec_1_neutral_loss_1022_flag "false" xref: spec_1_neutral_loss_1022_composition "Hex(2) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1022_mono_mass "1021.359809" xref: spec_2_neutral_loss_1022_avge_mass "1021.9208" xref: spec_2_neutral_loss_1022_flag "false" xref: spec_2_neutral_loss_1022_composition "Hex(2) HexNAc(2) NeuAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1022_mono_mass "1021.359809" xref: spec_2_neutral_loss_1022_avge_mass "1021.9208" xref: spec_2_neutral_loss_1022_flag "false" xref: spec_2_neutral_loss_1022_composition "Hex(2) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1451 name: Hex(3)HexNAc(2)Pent(1) def: "Hex(3) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1451] xref: record_id "1451" xref: delta_mono_mass "1024.359475" xref: delta_avge_mass "1024.9215" xref: delta_composition "Hex(3) HexNAc(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1025_mono_mass "1024.359475" xref: spec_1_neutral_loss_1025_avge_mass "1024.9215" xref: spec_1_neutral_loss_1025_flag "false" xref: spec_1_neutral_loss_1025_composition "Hex(3) HexNAc(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1452 name: Hex(4)HexNAc(2) def: "Hex(4) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1452] xref: record_id "1452" xref: delta_mono_mass "1054.370039" xref: delta_avge_mass "1054.9474" xref: delta_composition "Hex(4) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1055_mono_mass "1054.370039" xref: spec_1_neutral_loss_1055_avge_mass "1054.9474" xref: spec_1_neutral_loss_1055_flag "false" xref: spec_1_neutral_loss_1055_composition "Hex(4) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1453 name: dHex(1)Hex(4)HexNAc(1)Pent(1) def: "DHex Hex(4) HexNAc Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=1&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1453] xref: record_id "1453" xref: delta_mono_mass "1129.390834" xref: delta_avge_mass "1130.0107" xref: delta_composition "dHex(1) Hex(4) HexNAc(1) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1130_mono_mass "1129.390834" xref: spec_1_neutral_loss_1130_avge_mass "1130.0107" xref: spec_1_neutral_loss_1130_flag "false" xref: spec_1_neutral_loss_1130_composition "dHex(1) Hex(4) HexNAc(1) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1454 name: dHex(1)Hex(3)HexNAc(2)Pent(1) def: "DHex Hex(3) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1454] xref: record_id "1454" xref: delta_mono_mass "1170.417383" xref: delta_avge_mass "1171.0627" xref: delta_composition "dHex(1) Hex(3) HexNAc(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1171_mono_mass "1170.417383" xref: spec_1_neutral_loss_1171_avge_mass "1171.0627" xref: spec_1_neutral_loss_1171_flag "false" xref: spec_1_neutral_loss_1171_composition "dHex(1) Hex(3) HexNAc(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1455 name: Hex(3)HexNAc(2)NeuAc(1) def: "Hex(3) HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1455] xref: record_id "1455" xref: delta_mono_mass "1183.412632" xref: delta_avge_mass "1184.0614" xref: delta_composition "Hex(3) HexNAc(2) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1184_mono_mass "1183.412632" xref: spec_1_neutral_loss_1184_avge_mass "1184.0614" xref: spec_1_neutral_loss_1184_flag "false" xref: spec_1_neutral_loss_1184_composition "Hex(3) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1456 name: Hex(4)HexNAc(2)Pent(1) def: "Hex(4) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1456] xref: record_id "1456" xref: delta_mono_mass "1186.412298" xref: delta_avge_mass "1187.0621" xref: delta_composition "Hex(4) HexNAc(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1187_mono_mass "1186.412298" xref: spec_1_neutral_loss_1187_avge_mass "1187.0621" xref: spec_1_neutral_loss_1187_flag "false" xref: spec_1_neutral_loss_1187_composition "Hex(4) HexNAc(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1457 name: Hex(3)HexNAc(3)Pent(1) def: "Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1457] xref: record_id "1457" xref: delta_mono_mass "1227.438847" xref: delta_avge_mass "1228.114" xref: delta_composition "Hex(3) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1228_mono_mass "1227.438847" xref: spec_1_neutral_loss_1228_avge_mass "1228.114" xref: spec_1_neutral_loss_1228_flag "false" xref: spec_1_neutral_loss_1228_composition "Hex(3) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1458 name: Hex(5)HexNAc(2)Phos(1) def: "Hex(5) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1458] xref: record_id "1458" xref: delta_mono_mass "1296.389194" xref: delta_avge_mass "1297.0679" xref: delta_composition "H O(3) P Hex(5) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:43:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1297_mono_mass "1296.389194" xref: spec_1_neutral_loss_1297_avge_mass "1297.0679" xref: spec_1_neutral_loss_1297_flag "false" xref: spec_1_neutral_loss_1297_composition "H O(3) P Hex(5) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1459 name: dHex(1)Hex(4)HexNAc(2)Pent(1) def: "DHex Hex(4) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1459] xref: record_id "1459" xref: delta_mono_mass "1332.470207" xref: delta_avge_mass "1333.2033" xref: delta_composition "dHex(1) Hex(4) HexNAc(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1333_mono_mass "1332.470207" xref: spec_1_neutral_loss_1333_avge_mass "1333.2033" xref: spec_1_neutral_loss_1333_flag "false" xref: spec_1_neutral_loss_1333_composition "dHex(1) Hex(4) HexNAc(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1460 name: Hex(7)HexNAc(1) def: "Hex(7) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1460] xref: record_id "1460" xref: delta_mono_mass "1337.449137" xref: delta_avge_mass "1338.1767" xref: delta_composition "Hex(7) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1338_mono_mass "1337.449137" xref: spec_1_neutral_loss_1338_avge_mass "1338.1767" xref: spec_1_neutral_loss_1338_flag "false" xref: spec_1_neutral_loss_1338_composition "Hex(7) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1461 name: Hex(4)HexNAc(2)NeuAc(1) def: "Hex(4) HexNAc(2) NeuAc ---OR--- Hex(3) HexNAc(2) dHex NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1461] xref: record_id "1461" xref: delta_mono_mass "1345.465456" xref: delta_avge_mass "1346.202" xref: delta_composition "Hex(4) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 13:30:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1346_mono_mass "1345.465456" xref: spec_1_neutral_loss_1346_avge_mass "1346.202" xref: spec_1_neutral_loss_1346_flag "false" xref: spec_1_neutral_loss_1346_composition "Hex(4) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1346_mono_mass "1345.465456" xref: spec_2_neutral_loss_1346_avge_mass "1346.202" xref: spec_2_neutral_loss_1346_flag "false" xref: spec_2_neutral_loss_1346_composition "Hex(4) HexNAc(2) NeuAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1346_mono_mass "1345.465456" xref: spec_2_neutral_loss_1346_avge_mass "1346.202" xref: spec_2_neutral_loss_1346_flag "false" xref: spec_2_neutral_loss_1346_composition "Hex(4) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1462 name: dHex(1)Hex(5)HexNAc(2) def: "DHex Hex(5) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1462] xref: record_id "1462" xref: delta_mono_mass "1362.480772" xref: delta_avge_mass "1363.2292" xref: delta_composition "dHex(1) Hex(5) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1363_mono_mass "1362.480772" xref: spec_1_neutral_loss_1363_avge_mass "1363.2292" xref: spec_1_neutral_loss_1363_flag "false" xref: spec_1_neutral_loss_1363_composition "dHex(1) Hex(5) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1463 name: dHex(1)Hex(3)HexNAc(3)Pent(1) def: "DHex Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1463] xref: record_id "1463" xref: delta_mono_mass "1373.496756" xref: delta_avge_mass "1374.2552" xref: delta_composition "dHex(1) Hex(3) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1374_mono_mass "1373.496756" xref: spec_1_neutral_loss_1374_avge_mass "1374.2552" xref: spec_1_neutral_loss_1374_flag "false" xref: spec_1_neutral_loss_1374_composition "dHex(1) Hex(3) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1464 name: Hex(3)HexNAc(4)Sulf(1) def: "Hex(3) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1464] xref: record_id "1464" xref: delta_mono_mass "1378.432776" xref: delta_avge_mass "1379.2551" xref: delta_composition "O(3) S Hex(3) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:33:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1379_mono_mass "1378.432776" xref: spec_1_neutral_loss_1379_avge_mass "1379.2551" xref: spec_1_neutral_loss_1379_flag "false" xref: spec_1_neutral_loss_1379_composition "O(3) S Hex(3) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1465 name: Hex(6)HexNAc(2) def: "M6/Man6." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1465] xref: record_id "1465" xref: delta_mono_mass "1378.475686" xref: delta_avge_mass "1379.2286" xref: delta_composition "Hex(6) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:49:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1379_mono_mass "1378.475686" xref: spec_1_neutral_loss_1379_avge_mass "1379.2286" xref: spec_1_neutral_loss_1379_flag "false" xref: spec_1_neutral_loss_1379_composition "Hex(6) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1466 name: Hex(4)HexNAc(3)Pent(1) def: "Hex(4) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1466] xref: record_id "1466" xref: delta_mono_mass "1389.491671" xref: delta_avge_mass "1390.2546" xref: delta_composition "Hex(4) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1390_mono_mass "1389.491671" xref: spec_1_neutral_loss_1390_avge_mass "1390.2546" xref: spec_1_neutral_loss_1390_flag "false" xref: spec_1_neutral_loss_1390_composition "Hex(4) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1467 name: dHex(1)Hex(4)HexNAc(3) def: "DHex Hex(4) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1467] xref: record_id "1467" xref: delta_mono_mass "1403.507321" xref: delta_avge_mass "1404.2812" xref: delta_composition "dHex(1) Hex(4) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1404_mono_mass "1403.507321" xref: spec_1_neutral_loss_1404_avge_mass "1404.2812" xref: spec_1_neutral_loss_1404_flag "false" xref: spec_1_neutral_loss_1404_composition "dHex(1) Hex(4) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1468 name: Hex(5)HexNAc(3) def: "Hex(5) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1468] xref: record_id "1468" xref: delta_mono_mass "1419.502235" xref: delta_avge_mass "1420.2806" xref: delta_composition "Hex(5) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1420_mono_mass "1419.502235" xref: spec_1_neutral_loss_1420_avge_mass "1420.2806" xref: spec_1_neutral_loss_1420_flag "false" xref: spec_1_neutral_loss_1420_composition "Hex(5) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1469 name: Hex(3)HexNAc(4)Pent(1) def: "Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1469] xref: record_id "1469" xref: delta_mono_mass "1430.51822" xref: delta_avge_mass "1431.3065" xref: delta_composition "Hex(3) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1431_mono_mass "1430.51822" xref: spec_1_neutral_loss_1431_avge_mass "1431.3065" xref: spec_1_neutral_loss_1431_flag "false" xref: spec_1_neutral_loss_1431_composition "Hex(3) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1470 name: Hex(6)HexNAc(2)Phos(1) def: "Hex(6) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=6&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1470] xref: record_id "1470" xref: delta_mono_mass "1458.442017" xref: delta_avge_mass "1459.2085" xref: delta_composition "H O(3) P Hex(6) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:43:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1459_mono_mass "1458.442017" xref: spec_1_neutral_loss_1459_avge_mass "1459.2085" xref: spec_1_neutral_loss_1459_flag "false" xref: spec_1_neutral_loss_1459_composition "H O(3) P Hex(6) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1471 name: dHex(1)Hex(4)HexNAc(3)Sulf(1) def: "DHex Hex(4) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1471] xref: record_id "1471" xref: delta_mono_mass "1483.464135" xref: delta_avge_mass "1484.3444" xref: delta_composition "O(3) S dHex Hex(4) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:34:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1484_mono_mass "1483.464135" xref: spec_1_neutral_loss_1484_avge_mass "1484.3444" xref: spec_1_neutral_loss_1484_flag "false" xref: spec_1_neutral_loss_1484_composition "O(3) S dHex Hex(4) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1472 name: dHex(1)Hex(5)HexNAc(2)Pent(1) def: "DHex Hex(5) HexNAc(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1472] xref: record_id "1472" xref: delta_mono_mass "1494.52303" xref: delta_avge_mass "1495.3439" xref: delta_composition "dHex(1) Hex(5) HexNAc(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1495_mono_mass "1494.52303" xref: spec_1_neutral_loss_1495_avge_mass "1495.3439" xref: spec_1_neutral_loss_1495_flag "false" xref: spec_1_neutral_loss_1495_composition "dHex(1) Hex(5) HexNAc(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1473 name: Hex(8)HexNAc(1) def: "Hex(8) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=8&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1473] xref: record_id "1473" xref: delta_mono_mass "1499.501961" xref: delta_avge_mass "1500.3173" xref: delta_composition "Hex(8) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1500_mono_mass "1499.501961" xref: spec_1_neutral_loss_1500_avge_mass "1500.3173" xref: spec_1_neutral_loss_1500_flag "false" xref: spec_1_neutral_loss_1500_composition "Hex(8) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1474 name: dHex(1)Hex(3)HexNAc(3)Pent(2) def: "DHex Hex(3) HexNAc(3) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1474] xref: record_id "1474" xref: delta_mono_mass "1505.539015" xref: delta_avge_mass "1506.3698" xref: delta_composition "dHex(1) Hex(3) HexNAc(3) Pent(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1506_mono_mass "1505.539015" xref: spec_1_neutral_loss_1506_avge_mass "1506.3698" xref: spec_1_neutral_loss_1506_flag "false" xref: spec_1_neutral_loss_1506_composition "dHex(1) Hex(3) HexNAc(3) Pent(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1475 name: dHex(2)Hex(3)HexNAc(3)Pent(1) def: "DHex(2) Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1475] xref: record_id "1475" xref: delta_mono_mass "1519.554665" xref: delta_avge_mass "1520.3964" xref: delta_composition "dHex(2) Hex(3) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1520_mono_mass "1519.554665" xref: spec_1_neutral_loss_1520_avge_mass "1520.3964" xref: spec_1_neutral_loss_1520_flag "false" xref: spec_1_neutral_loss_1520_composition "dHex(2) Hex(3) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1476 name: dHex(1)Hex(3)HexNAc(4)Sulf(1) def: "DHex Hex(3) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1476] xref: record_id "1476" xref: delta_mono_mass "1524.490684" xref: delta_avge_mass "1525.3963" xref: delta_composition "O(3) S dHex Hex(3) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:34:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1525_mono_mass "1524.490684" xref: spec_1_neutral_loss_1525_avge_mass "1525.3963" xref: spec_1_neutral_loss_1525_flag "false" xref: spec_1_neutral_loss_1525_composition "O(3) S dHex Hex(3) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1477 name: dHex(1)Hex(6)HexNAc(2) def: "DHex Hex(6) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1477] xref: record_id "1477" xref: delta_mono_mass "1524.533595" xref: delta_avge_mass "1525.3698" xref: delta_composition "dHex(1) Hex(6) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1525_mono_mass "1524.533595" xref: spec_1_neutral_loss_1525_avge_mass "1525.3698" xref: spec_1_neutral_loss_1525_flag "false" xref: spec_1_neutral_loss_1525_composition "dHex(1) Hex(6) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1478 name: dHex(1)Hex(4)HexNAc(3)Pent(1) def: "DHex Hex(4) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1478] xref: record_id "1478" xref: delta_mono_mass "1535.549579" xref: delta_avge_mass "1536.3958" xref: delta_composition "dHex(1) Hex(4) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1536_mono_mass "1535.549579" xref: spec_1_neutral_loss_1536_avge_mass "1536.3958" xref: spec_1_neutral_loss_1536_flag "false" xref: spec_1_neutral_loss_1536_composition "dHex(1) Hex(4) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1479 name: Hex(4)HexNAc(4)Sulf(1) def: "Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1479] xref: record_id "1479" xref: delta_mono_mass "1540.485599" xref: delta_avge_mass "1541.3957" xref: delta_composition "O(3) S Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:34:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1541_mono_mass "1540.485599" xref: spec_1_neutral_loss_1541_avge_mass "1541.3957" xref: spec_1_neutral_loss_1541_flag "false" xref: spec_1_neutral_loss_1541_composition "O(3) S Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1480 name: Hex(7)HexNAc(2) def: "M7/Man7." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1480] xref: record_id "1480" xref: delta_mono_mass "1540.52851" xref: delta_avge_mass "1541.3692" xref: delta_composition "Hex(7) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:49:23" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1541_mono_mass "1540.52851" xref: spec_1_neutral_loss_1541_avge_mass "1541.3692" xref: spec_1_neutral_loss_1541_flag "false" xref: spec_1_neutral_loss_1541_composition "Hex(7) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1481 name: dHex(2)Hex(4)HexNAc(3) def: "DHex(2) Hex(4) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1481] xref: record_id "1481" xref: delta_mono_mass "1549.56523" xref: delta_avge_mass "1550.4224" xref: delta_composition "dHex(2) Hex(4) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1550_mono_mass "1549.56523" xref: spec_1_neutral_loss_1550_avge_mass "1550.4224" xref: spec_1_neutral_loss_1550_flag "false" xref: spec_1_neutral_loss_1550_composition "dHex(2) Hex(4) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1482 name: Hex(5)HexNAc(3)Pent(1) def: "Hex(5) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1482] xref: record_id "1482" xref: delta_mono_mass "1551.544494" xref: delta_avge_mass "1552.3952" xref: delta_composition "Hex(5) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1552_mono_mass "1551.544494" xref: spec_1_neutral_loss_1552_avge_mass "1552.3952" xref: spec_1_neutral_loss_1552_flag "false" xref: spec_1_neutral_loss_1552_composition "Hex(5) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1483 name: Hex(4)HexNAc(3)NeuGc(1) def: "Hex(4) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1483] xref: record_id "1483" xref: delta_mono_mass "1564.539743" xref: delta_avge_mass "1565.3939" xref: delta_composition "Hex(4) HexNAc(3) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1565_mono_mass "1564.539743" xref: spec_1_neutral_loss_1565_avge_mass "1565.3939" xref: spec_1_neutral_loss_1565_flag "false" xref: spec_1_neutral_loss_1565_composition "Hex(4) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1484 name: dHex(1)Hex(5)HexNAc(3) def: "DHex Hex(5) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1484] xref: record_id "1484" xref: delta_mono_mass "1565.560144" xref: delta_avge_mass "1566.4218" xref: delta_composition "dHex(1) Hex(5) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1566_mono_mass "1565.560144" xref: spec_1_neutral_loss_1566_avge_mass "1566.4218" xref: spec_1_neutral_loss_1566_flag "false" xref: spec_1_neutral_loss_1566_composition "dHex(1) Hex(5) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1485 name: dHex(1)Hex(3)HexNAc(4)Pent(1) def: "DHex Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1485] xref: record_id "1485" xref: delta_mono_mass "1576.576129" xref: delta_avge_mass "1577.4477" xref: delta_composition "dHex(1) Hex(3) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1577_mono_mass "1576.576129" xref: spec_1_neutral_loss_1577_avge_mass "1577.4477" xref: spec_1_neutral_loss_1577_flag "false" xref: spec_1_neutral_loss_1577_composition "dHex(1) Hex(3) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1486 name: Hex(3)HexNAc(5)Sulf(1) def: "Hex(3) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1486] xref: record_id "1486" xref: delta_mono_mass "1581.512148" xref: delta_avge_mass "1582.4476" xref: delta_composition "O(3) S Hex(3) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:35:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1582_mono_mass "1581.512148" xref: spec_1_neutral_loss_1582_avge_mass "1582.4476" xref: spec_1_neutral_loss_1582_flag "false" xref: spec_1_neutral_loss_1582_composition "O(3) S Hex(3) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1487 name: Hex(6)HexNAc(3) def: "Hex(6) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1487] xref: record_id "1487" xref: delta_mono_mass "1581.555059" xref: delta_avge_mass "1582.4212" xref: delta_composition "Hex(6) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1582_mono_mass "1581.555059" xref: spec_1_neutral_loss_1582_avge_mass "1582.4212" xref: spec_1_neutral_loss_1582_flag "false" xref: spec_1_neutral_loss_1582_composition "Hex(6) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1488 name: Hex(3)HexNAc(4)NeuAc(1) def: "Hex(3) HexNAc(4) NeuAc ---OR--- Hex(2) HexNAc(4) dHex NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1488] xref: record_id "1488" xref: delta_mono_mass "1589.571378" xref: delta_avge_mass "1590.4465" xref: delta_composition "Hex(3) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 16:47:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1590_mono_mass "1589.571378" xref: spec_1_neutral_loss_1590_avge_mass "1590.4465" xref: spec_1_neutral_loss_1590_flag "false" xref: spec_1_neutral_loss_1590_composition "Hex(3) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1489 name: Hex(4)HexNAc(4)Pent(1) def: "Hex(4) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1489] xref: record_id "1489" xref: delta_mono_mass "1592.571043" xref: delta_avge_mass "1593.4471" xref: delta_composition "Hex(4) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1593_mono_mass "1592.571043" xref: spec_1_neutral_loss_1593_avge_mass "1593.4471" xref: spec_1_neutral_loss_1593_flag "false" xref: spec_1_neutral_loss_1593_composition "Hex(4) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1490 name: Hex(7)HexNAc(2)Phos(1) def: "Hex(7) HexNAc(2) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1490] xref: record_id "1490" xref: delta_mono_mass "1620.494841" xref: delta_avge_mass "1621.3491" xref: delta_composition "H O(3) P Hex(7) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:43:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1621_mono_mass "1620.494841" xref: spec_1_neutral_loss_1621_avge_mass "1621.3491" xref: spec_1_neutral_loss_1621_flag "false" xref: spec_1_neutral_loss_1621_composition "H O(3) P Hex(7) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1491 name: Hex(4)HexNAc(4)Me(2)Pent(1) def: "Hex(4) HexNAc(4) Me(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&methyl=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1491] xref: record_id "1491" xref: delta_mono_mass "1620.602343" xref: delta_avge_mass "1621.5003" xref: delta_composition "Hex(4) HexNAc(4) Me(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1621_mono_mass "1620.602343" xref: spec_1_neutral_loss_1621_avge_mass "1621.5003" xref: spec_1_neutral_loss_1621_flag "false" xref: spec_1_neutral_loss_1621_composition "Hex(4) HexNAc(4) Me(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1492 name: dHex(1)Hex(3)HexNAc(3)Pent(3) def: "DHex Hex(3) HexNAc(3) Pent(3) ---OR--- Hex(4) HexNAc(2) dHex(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=3&dhex=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1492] xref: record_id "1492" xref: delta_mono_mass "1637.581274" xref: delta_avge_mass "1638.4844" xref: delta_composition "Pent(3) dHex Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 10:46:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1638_mono_mass "1637.581274" xref: spec_1_neutral_loss_1638_avge_mass "1638.4844" xref: spec_1_neutral_loss_1638_flag "false" xref: spec_1_neutral_loss_1638_composition "Pent(3) dHex Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1493 name: dHex(1)Hex(5)HexNAc(3)Sulf(1) def: "DHex Hex(5) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1493] xref: record_id "1493" xref: delta_mono_mass "1645.516959" xref: delta_avge_mass "1646.485" xref: delta_composition "O(3) S dHex Hex(5) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:35:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1646_mono_mass "1645.516959" xref: spec_1_neutral_loss_1646_avge_mass "1646.485" xref: spec_1_neutral_loss_1646_flag "false" xref: spec_1_neutral_loss_1646_composition "O(3) S dHex Hex(5) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1494 name: dHex(2)Hex(3)HexNAc(3)Pent(2) def: "DHex(2) Hex(3) HexNAc(3) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1494] xref: record_id "1494" xref: delta_mono_mass "1651.596924" xref: delta_avge_mass "1652.511" xref: delta_composition "dHex(2) Hex(3) HexNAc(3) Pent(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1652_mono_mass "1651.596924" xref: spec_1_neutral_loss_1652_avge_mass "1652.511" xref: spec_1_neutral_loss_1652_flag "false" xref: spec_1_neutral_loss_1652_composition "dHex(2) Hex(3) HexNAc(3) Pent(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1495 name: Hex(6)HexNAc(3)Phos(1) def: "Hex(6) HexNAc(3) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1495] xref: record_id "1495" xref: delta_mono_mass "1661.52139" xref: delta_avge_mass "1662.4011" xref: delta_composition "H O(3) P Hex(6) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:43:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1662_mono_mass "1661.52139" xref: spec_1_neutral_loss_1662_avge_mass "1662.4011" xref: spec_1_neutral_loss_1662_flag "false" xref: spec_1_neutral_loss_1662_composition "H O(3) P Hex(6) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1496 name: Hex(4)HexNAc(5) def: "Hex(4) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1496] xref: record_id "1496" xref: delta_mono_mass "1663.608157" xref: delta_avge_mass "1664.525" xref: delta_composition "Hex(4) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1664_mono_mass "1663.608157" xref: spec_1_neutral_loss_1664_avge_mass "1664.525" xref: spec_1_neutral_loss_1664_flag "false" xref: spec_1_neutral_loss_1664_composition "Hex(4) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1497 name: dHex(3)Hex(3)HexNAc(3)Pent(1) def: "DHex(3) Hex(3) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1497] xref: record_id "1497" xref: delta_mono_mass "1665.612574" xref: delta_avge_mass "1666.5376" xref: delta_composition "dHex(3) Hex(3) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1666_mono_mass "1665.612574" xref: spec_1_neutral_loss_1666_avge_mass "1666.5376" xref: spec_1_neutral_loss_1666_flag "false" xref: spec_1_neutral_loss_1666_composition "dHex(3) Hex(3) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1498 name: dHex(2)Hex(4)HexNAc(3)Pent(1) def: "DHex(2) Hex(4) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1498] xref: record_id "1498" xref: delta_mono_mass "1681.607488" xref: delta_avge_mass "1682.537" xref: delta_composition "dHex(2) Hex(4) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1682_mono_mass "1681.607488" xref: spec_1_neutral_loss_1682_avge_mass "1682.537" xref: spec_1_neutral_loss_1682_flag "false" xref: spec_1_neutral_loss_1682_composition "dHex(2) Hex(4) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1499 name: dHex(1)Hex(4)HexNAc(4)Sulf(1) def: "DHex Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1499] xref: record_id "1499" xref: delta_mono_mass "1686.543508" xref: delta_avge_mass "1687.5369" xref: delta_composition "O(3) S dHex Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:35:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1687_mono_mass "1686.543508" xref: spec_1_neutral_loss_1687_avge_mass "1687.5369" xref: spec_1_neutral_loss_1687_flag "false" xref: spec_1_neutral_loss_1687_composition "O(3) S dHex Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1500 name: dHex(1)Hex(7)HexNAc(2) def: "DHex Hex(7) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1500] xref: record_id "1500" xref: delta_mono_mass "1686.586419" xref: delta_avge_mass "1687.5104" xref: delta_composition "dHex(1) Hex(7) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1687_mono_mass "1686.586419" xref: spec_1_neutral_loss_1687_avge_mass "1687.5104" xref: spec_1_neutral_loss_1687_flag "false" xref: spec_1_neutral_loss_1687_composition "dHex(1) Hex(7) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1501 name: dHex(1)Hex(4)HexNAc(3)NeuAc(1) def: "DHex Hex(4) HexNAc(3) NeuAc ---OR--- dHex(2) Hex(3) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1501] xref: record_id "1501" xref: delta_mono_mass "1694.602737" xref: delta_avge_mass "1695.5357" xref: delta_composition "dHex Hex(4) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 10:54:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1695_mono_mass "1694.602737" xref: spec_1_neutral_loss_1695_avge_mass "1695.5357" xref: spec_1_neutral_loss_1695_flag "false" xref: spec_1_neutral_loss_1695_composition "dHex Hex(4) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1695_mono_mass "1694.602737" xref: spec_2_neutral_loss_1695_avge_mass "1695.5357" xref: spec_2_neutral_loss_1695_flag "false" xref: spec_2_neutral_loss_1695_composition "dHex Hex(4) HexNAc(3) NeuAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1695_mono_mass "1694.602737" xref: spec_2_neutral_loss_1695_avge_mass "1695.5357" xref: spec_2_neutral_loss_1695_flag "false" xref: spec_2_neutral_loss_1695_composition "dHex Hex(4) HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1502 name: Hex(7)HexNAc(2)Phos(2) def: "Hex(7) HexNAc(2) Phos(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=2&hex=7&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1502] xref: record_id "1502" xref: delta_mono_mass "1700.461172" xref: delta_avge_mass "1701.329" xref: delta_composition "H(2) O(6) P(2) Hex(7) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:44:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1701_mono_mass "1700.461172" xref: spec_1_neutral_loss_1701_avge_mass "1701.329" xref: spec_1_neutral_loss_1701_flag "false" xref: spec_1_neutral_loss_1701_composition "H(2) O(6) P(2) Hex(7) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1503 name: Hex(5)HexNAc(4)Sulf(1) def: "Hex(5) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1503] xref: record_id "1503" xref: delta_mono_mass "1702.538423" xref: delta_avge_mass "1703.5363" xref: delta_composition "O(3) S Hex(5) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:35:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1703_mono_mass "1702.538423" xref: spec_1_neutral_loss_1703_avge_mass "1703.5363" xref: spec_1_neutral_loss_1703_flag "false" xref: spec_1_neutral_loss_1703_composition "O(3) S Hex(5) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1504 name: Hex(8)HexNAc(2) def: "M8/Man8." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=8&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1504] xref: record_id "1504" xref: delta_mono_mass "1702.581333" xref: delta_avge_mass "1703.5098" xref: delta_composition "Hex(8) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:49:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1703_mono_mass "1702.581333" xref: spec_1_neutral_loss_1703_avge_mass "1703.5098" xref: spec_1_neutral_loss_1703_flag "false" xref: spec_1_neutral_loss_1703_composition "Hex(8) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1505 name: dHex(1)Hex(3)HexNAc(4)Pent(2) def: "DHex Hex(3) HexNAc(4) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1505] xref: record_id "1505" xref: delta_mono_mass "1708.618387" xref: delta_avge_mass "1709.5623" xref: delta_composition "dHex(1) Hex(3) HexNAc(4) Pent(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1709_mono_mass "1708.618387" xref: spec_1_neutral_loss_1709_avge_mass "1709.5623" xref: spec_1_neutral_loss_1709_flag "false" xref: spec_1_neutral_loss_1709_composition "dHex(1) Hex(3) HexNAc(4) Pent(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1506 name: dHex(1)Hex(4)HexNAc(3)NeuGc(1) def: "DHex Hex(4) HexNAc(3) NeuGc ---OR--- Hex(5) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1506] xref: record_id "1506" xref: delta_mono_mass "1710.597652" xref: delta_avge_mass "1711.5351" xref: delta_composition "dHex Hex(4) HexNAc(3) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 11:04:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1711_mono_mass "1710.597652" xref: spec_1_neutral_loss_1711_avge_mass "1711.5351" xref: spec_1_neutral_loss_1711_flag "false" xref: spec_1_neutral_loss_1711_composition "dHex Hex(4) HexNAc(3) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1507 name: dHex(2)Hex(3)HexNAc(4)Pent(1) def: "DHex(2) Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1507] xref: record_id "1507" xref: delta_mono_mass "1722.634037" xref: delta_avge_mass "1723.5889" xref: delta_composition "dHex(2) Hex(3) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1723_mono_mass "1722.634037" xref: spec_1_neutral_loss_1723_avge_mass "1723.5889" xref: spec_1_neutral_loss_1723_flag "false" xref: spec_1_neutral_loss_1723_composition "dHex(2) Hex(3) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1508 name: dHex(1)Hex(3)HexNAc(5)Sulf(1) def: "DHex Hex(3) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1508] xref: record_id "1508" xref: delta_mono_mass "1727.570057" xref: delta_avge_mass "1728.5888" xref: delta_composition "O(3) S dHex Hex(3) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:36:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1728_mono_mass "1727.570057" xref: spec_1_neutral_loss_1728_avge_mass "1728.5888" xref: spec_1_neutral_loss_1728_flag "false" xref: spec_1_neutral_loss_1728_composition "O(3) S dHex Hex(3) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1509 name: dHex(1)Hex(6)HexNAc(3) def: "DHex Hex(6) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1509] xref: record_id "1509" xref: delta_mono_mass "1727.612968" xref: delta_avge_mass "1728.5624" xref: delta_composition "dHex(1) Hex(6) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1728_mono_mass "1727.612968" xref: spec_1_neutral_loss_1728_avge_mass "1728.5624" xref: spec_1_neutral_loss_1728_flag "false" xref: spec_1_neutral_loss_1728_composition "dHex(1) Hex(6) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1510 name: dHex(1)Hex(3)HexNAc(4)NeuAc(1) def: "DHex Hex(3) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1510] xref: record_id "1510" xref: delta_mono_mass "1735.629286" xref: delta_avge_mass "1736.5877" xref: delta_composition "dHex(1) Hex(3) HexNAc(4) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1736_mono_mass "1735.629286" xref: spec_1_neutral_loss_1736_avge_mass "1736.5877" xref: spec_1_neutral_loss_1736_flag "false" xref: spec_1_neutral_loss_1736_composition "dHex(1) Hex(3) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1511 name: dHex(3)Hex(3)HexNAc(4) def: "DHex(3) Hex(3) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1511] xref: record_id "1511" xref: delta_mono_mass "1736.649688" xref: delta_avge_mass "1737.6155" xref: delta_composition "dHex(3) Hex(3) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1737_mono_mass "1736.649688" xref: spec_1_neutral_loss_1737_avge_mass "1737.6155" xref: spec_1_neutral_loss_1737_flag "false" xref: spec_1_neutral_loss_1737_composition "dHex(3) Hex(3) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1512 name: dHex(1)Hex(4)HexNAc(4)Pent(1) def: "DHex Hex(4) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1512] xref: record_id "1512" xref: delta_mono_mass "1738.628952" xref: delta_avge_mass "1739.5883" xref: delta_composition "dHex(1) Hex(4) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1739_mono_mass "1738.628952" xref: spec_1_neutral_loss_1739_avge_mass "1739.5883" xref: spec_1_neutral_loss_1739_flag "false" xref: spec_1_neutral_loss_1739_composition "dHex(1) Hex(4) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1513 name: Hex(4)HexNAc(5)Sulf(1) def: "Hex(4) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1513] xref: record_id "1513" xref: delta_mono_mass "1743.564972" xref: delta_avge_mass "1744.5882" xref: delta_composition "O(3) S Hex(4) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:36:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1744_mono_mass "1743.564972" xref: spec_1_neutral_loss_1744_avge_mass "1744.5882" xref: spec_1_neutral_loss_1744_flag "false" xref: spec_1_neutral_loss_1744_composition "O(3) S Hex(4) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1514 name: Hex(7)HexNAc(3) def: "Hex(7) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1514] xref: record_id "1514" xref: delta_mono_mass "1743.607882" xref: delta_avge_mass "1744.5618" xref: delta_composition "Hex(7) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1744_mono_mass "1743.607882" xref: spec_1_neutral_loss_1744_avge_mass "1744.5618" xref: spec_1_neutral_loss_1744_flag "false" xref: spec_1_neutral_loss_1744_composition "Hex(7) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1515 name: dHex(1)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) def: "DHex Hex(4) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1515] xref: record_id "1515" xref: delta_mono_mass "1774.559552" xref: delta_avge_mass "1775.5989" xref: delta_composition "O(3) S dHex Hex(4) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:36:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1775_mono_mass "1774.559552" xref: spec_1_neutral_loss_1775_avge_mass "1775.5989" xref: spec_1_neutral_loss_1775_flag "false" xref: spec_1_neutral_loss_1775_composition "O(3) S dHex Hex(4) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1516 name: Hex(5)HexNAc(4)Me(2)Pent(1) def: "Hex(5) HexNAc(4) Me(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&methyl=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1516] xref: record_id "1516" xref: delta_mono_mass "1782.655167" xref: delta_avge_mass "1783.6409" xref: delta_composition "Hex(5) HexNAc(4) Me(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1783_mono_mass "1782.655167" xref: spec_1_neutral_loss_1783_avge_mass "1783.6409" xref: spec_1_neutral_loss_1783_flag "false" xref: spec_1_neutral_loss_1783_composition "Hex(5) HexNAc(4) Me(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1517 name: Hex(3)HexNAc(6)Sulf(1) def: "Hex(3) HexNAc(6) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1517] xref: record_id "1517" xref: delta_mono_mass "1784.591521" xref: delta_avge_mass "1785.6401" xref: delta_composition "O(3) S Hex(3) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:36:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1785_mono_mass "1784.591521" xref: spec_1_neutral_loss_1785_avge_mass "1785.6401" xref: spec_1_neutral_loss_1785_flag "false" xref: spec_1_neutral_loss_1785_composition "O(3) S Hex(3) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1518 name: dHex(1)Hex(6)HexNAc(3)Sulf(1) def: "DHex Hex(6) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=6&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1518] xref: record_id "1518" xref: delta_mono_mass "1807.569782" xref: delta_avge_mass "1808.6256" xref: delta_composition "O(3) S dHex Hex(6) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:36:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1808_mono_mass "1807.569782" xref: spec_1_neutral_loss_1808_avge_mass "1808.6256" xref: spec_1_neutral_loss_1808_flag "false" xref: spec_1_neutral_loss_1808_composition "O(3) S dHex Hex(6) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1519 name: dHex(1)Hex(4)HexNAc(5) def: "DHex Hex(4) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1519] xref: record_id "1519" xref: delta_mono_mass "1809.666066" xref: delta_avge_mass "1810.6662" xref: delta_composition "dHex(1) Hex(4) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1810_mono_mass "1809.666066" xref: spec_1_neutral_loss_1810_avge_mass "1810.6662" xref: spec_1_neutral_loss_1810_flag "false" xref: spec_1_neutral_loss_1810_composition "dHex(1) Hex(4) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1520 name: dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(1) def: "DHex Hex(5) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1520] xref: record_id "1520" xref: delta_mono_mass "1821.549047" xref: delta_avge_mass "1822.6091" xref: delta_composition "O(3) S dHex Hex(5) HexA HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:37:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1822_mono_mass "1821.549047" xref: spec_1_neutral_loss_1822_avge_mass "1822.6091" xref: spec_1_neutral_loss_1822_flag "false" xref: spec_1_neutral_loss_1822_composition "O(3) S dHex Hex(5) HexA HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1521 name: Hex(7)HexNAc(3)Phos(1) def: "Hex(7) HexNAc(3) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1521] xref: record_id "1521" xref: delta_mono_mass "1823.574213" xref: delta_avge_mass "1824.5417" xref: delta_composition "H O(3) P Hex(7) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:44:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1824_mono_mass "1823.574213" xref: spec_1_neutral_loss_1824_avge_mass "1824.5417" xref: spec_1_neutral_loss_1824_flag "false" xref: spec_1_neutral_loss_1824_composition "H O(3) P Hex(7) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1522 name: Hex(6)HexNAc(4)Me(3) def: "Hex(6) HexNAc(4) Me(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=4&methyl=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1522] xref: record_id "1522" xref: delta_mono_mass "1826.681382" xref: delta_avge_mass "1827.6934" xref: delta_composition "Hex(6) HexNAc(4) Me(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1827_mono_mass "1826.681382" xref: spec_1_neutral_loss_1827_avge_mass "1827.6934" xref: spec_1_neutral_loss_1827_flag "false" xref: spec_1_neutral_loss_1827_composition "Hex(6) HexNAc(4) Me(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1523 name: dHex(2)Hex(4)HexNAc(4)Sulf(1) def: "DHex(2) Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1523] xref: record_id "1523" xref: delta_mono_mass "1832.601417" xref: delta_avge_mass "1833.6781" xref: delta_composition "O(3) S dHex(2) Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:37:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1833_mono_mass "1832.601417" xref: spec_1_neutral_loss_1833_avge_mass "1833.6781" xref: spec_1_neutral_loss_1833_flag "false" xref: spec_1_neutral_loss_1833_composition "O(3) S dHex(2) Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1524 name: Hex(4)HexNAc(3)NeuAc(2) def: "Hex(4) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1524] xref: record_id "1524" xref: delta_mono_mass "1839.640245" xref: delta_avge_mass "1840.6491" xref: delta_composition "Hex(4) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1840_mono_mass "1839.640245" xref: spec_1_neutral_loss_1840_avge_mass "1840.6491" xref: spec_1_neutral_loss_1840_flag "false" xref: spec_1_neutral_loss_1840_composition "Hex(4) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1525 name: dHex(1)Hex(3)HexNAc(4)Pent(3) def: "DHex Hex(3) HexNAc(4) Pent(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=4&pent=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1525] xref: record_id "1525" xref: delta_mono_mass "1840.660646" xref: delta_avge_mass "1841.6769" xref: delta_composition "dHex(1) Hex(3) HexNAc(4) Pent(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1841_mono_mass "1840.660646" xref: spec_1_neutral_loss_1841_avge_mass "1841.6769" xref: spec_1_neutral_loss_1841_flag "false" xref: spec_1_neutral_loss_1841_composition "dHex(1) Hex(3) HexNAc(4) Pent(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1526 name: dHex(2)Hex(5)HexNAc(3)Pent(1) def: "DHex(2) Hex(5) HexNAc(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=5&hexnac=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1526] xref: record_id "1526" xref: delta_mono_mass "1843.660312" xref: delta_avge_mass "1844.6776" xref: delta_composition "dHex(2) Hex(5) HexNAc(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1844_mono_mass "1843.660312" xref: spec_1_neutral_loss_1844_avge_mass "1844.6776" xref: spec_1_neutral_loss_1844_flag "false" xref: spec_1_neutral_loss_1844_composition "dHex(2) Hex(5) HexNAc(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1527 name: dHex(1)Hex(5)HexNAc(4)Sulf(1) def: "DHex Hex(5) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1527] xref: record_id "1527" xref: delta_mono_mass "1848.596331" xref: delta_avge_mass "1849.6775" xref: delta_composition "O(3) S dHex Hex(5) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:37:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1849_mono_mass "1848.596331" xref: spec_1_neutral_loss_1849_avge_mass "1849.6775" xref: spec_1_neutral_loss_1849_flag "false" xref: spec_1_neutral_loss_1849_composition "O(3) S dHex Hex(5) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1528 name: dHex(2)Hex(3)HexNAc(4)Pent(2) def: "DHex(2) Hex(3) HexNAc(4) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1528] xref: record_id "1528" xref: delta_mono_mass "1854.676296" xref: delta_avge_mass "1855.7035" xref: delta_composition "dHex(2) Hex(3) HexNAc(4) Pent(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1855_mono_mass "1854.676296" xref: spec_1_neutral_loss_1855_avge_mass "1855.7035" xref: spec_1_neutral_loss_1855_flag "false" xref: spec_1_neutral_loss_1855_composition "dHex(2) Hex(3) HexNAc(4) Pent(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1529 name: dHex(1)Hex(5)HexNAc(3)NeuAc(1) def: "DHex Hex(5) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1529] xref: record_id "1529" xref: delta_mono_mass "1856.655561" xref: delta_avge_mass "1857.6763" xref: delta_composition "dHex(1) Hex(5) HexNAc(3) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1857_mono_mass "1856.655561" xref: spec_1_neutral_loss_1857_avge_mass "1857.6763" xref: spec_1_neutral_loss_1857_flag "false" xref: spec_1_neutral_loss_1857_composition "dHex(1) Hex(5) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1530 name: Hex(3)HexNAc(6)Sulf(2) def: "Hex(3) HexNAc(6) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1530] xref: record_id "1530" xref: delta_mono_mass "1864.548335" xref: delta_avge_mass "1865.7033" xref: delta_composition "O(6) S(2) Hex(3) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:37:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1865_mono_mass "1864.548335" xref: spec_1_neutral_loss_1865_avge_mass "1865.7033" xref: spec_1_neutral_loss_1865_flag "false" xref: spec_1_neutral_loss_1865_composition "O(6) S(2) Hex(3) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1531 name: Hex(9)HexNAc(2) def: "M9/Man9." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=9&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1531] xref: record_id "1531" xref: delta_mono_mass "1864.634157" xref: delta_avge_mass "1865.6504" xref: delta_composition "Hex(9) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:48:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1865_mono_mass "1864.634157" xref: spec_1_neutral_loss_1865_avge_mass "1865.6504" xref: spec_1_neutral_loss_1865_flag "false" xref: spec_1_neutral_loss_1865_composition "Hex(9) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1532 name: Hex(4)HexNAc(6) def: "Hex(4) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1532] xref: record_id "1532" xref: delta_mono_mass "1866.68753" xref: delta_avge_mass "1867.7175" xref: delta_composition "Hex(4) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1867_mono_mass "1866.68753" xref: spec_1_neutral_loss_1867_avge_mass "1867.7175" xref: spec_1_neutral_loss_1867_flag "false" xref: spec_1_neutral_loss_1867_composition "Hex(4) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1533 name: dHex(3)Hex(3)HexNAc(4)Pent(1) def: "DHex(3) Hex(3) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1533] xref: record_id "1533" xref: delta_mono_mass "1868.691946" xref: delta_avge_mass "1869.7301" xref: delta_composition "dHex(3) Hex(3) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1869_mono_mass "1868.691946" xref: spec_1_neutral_loss_1869_avge_mass "1869.7301" xref: spec_1_neutral_loss_1869_flag "false" xref: spec_1_neutral_loss_1869_composition "dHex(3) Hex(3) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1534 name: dHex(1)Hex(5)HexNAc(3)NeuGc(1) def: "DHex Hex(5) HexNAc(3) NeuGc ---OR--- Hex(6) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1534] xref: record_id "1534" xref: delta_mono_mass "1872.650475" xref: delta_avge_mass "1873.6757" xref: delta_composition "dHex Hex(5) HexNAc(3) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 11:15:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1873_mono_mass "1872.650475" xref: spec_1_neutral_loss_1873_avge_mass "1873.6757" xref: spec_1_neutral_loss_1873_flag "false" xref: spec_1_neutral_loss_1873_composition "dHex Hex(5) HexNAc(3) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1535 name: dHex(2)Hex(4)HexNAc(4)Pent(1) def: "DHex(2) Hex(4) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1535] xref: record_id "1535" xref: delta_mono_mass "1884.686861" xref: delta_avge_mass "1885.7295" xref: delta_composition "dHex(2) Hex(4) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1885_mono_mass "1884.686861" xref: spec_1_neutral_loss_1885_avge_mass "1885.7295" xref: spec_1_neutral_loss_1885_flag "false" xref: spec_1_neutral_loss_1885_composition "dHex(2) Hex(4) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1536 name: dHex(1)Hex(4)HexNAc(5)Sulf(1) def: "DHex Hex(4) HexNAc(5) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1536] xref: record_id "1536" xref: delta_mono_mass "1889.62288" xref: delta_avge_mass "1890.7294" xref: delta_composition "O(3) S dHex Hex(4) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:37:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1890_mono_mass "1889.62288" xref: spec_1_neutral_loss_1890_avge_mass "1890.7294" xref: spec_1_neutral_loss_1890_flag "false" xref: spec_1_neutral_loss_1890_composition "O(3) S dHex Hex(4) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1537 name: dHex(1)Hex(7)HexNAc(3) def: "DHex Hex(7) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1537] xref: record_id "1537" xref: delta_mono_mass "1889.665791" xref: delta_avge_mass "1890.703" xref: delta_composition "dHex(1) Hex(7) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1890_mono_mass "1889.665791" xref: spec_1_neutral_loss_1890_avge_mass "1890.703" xref: spec_1_neutral_loss_1890_flag "false" xref: spec_1_neutral_loss_1890_composition "dHex(1) Hex(7) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1538 name: dHex(1)Hex(5)HexNAc(4)Pent(1) def: "DHex Hex(5) HexNAc(4) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1538] xref: record_id "1538" xref: delta_mono_mass "1900.681776" xref: delta_avge_mass "1901.7289" xref: delta_composition "dHex(1) Hex(5) HexNAc(4) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1901_mono_mass "1900.681776" xref: spec_1_neutral_loss_1901_avge_mass "1901.7289" xref: spec_1_neutral_loss_1901_flag "false" xref: spec_1_neutral_loss_1901_composition "dHex(1) Hex(5) HexNAc(4) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1539 name: dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(2) def: "DHex Hex(5) HexA HexNAc(3) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=1&hex=5&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1539] xref: record_id "1539" xref: delta_mono_mass "1901.505861" xref: delta_avge_mass "1902.6723" xref: delta_composition "O(6) S(2) dHex Hex(5) HexA HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:38:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1902_mono_mass "1901.505861" xref: spec_1_neutral_loss_1902_avge_mass "1902.6723" xref: spec_1_neutral_loss_1902_flag "false" xref: spec_1_neutral_loss_1902_composition "O(6) S(2) dHex Hex(5) HexA HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1540 name: Hex(3)HexNAc(7) def: "Hex(3) HexNAc(7)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1540] xref: record_id "1540" xref: delta_mono_mass "1907.714079" xref: delta_avge_mass "1908.7694" xref: delta_composition "Hex(3) HexNAc(7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1908_mono_mass "1907.714079" xref: spec_1_neutral_loss_1908_avge_mass "1908.7694" xref: spec_1_neutral_loss_1908_flag "false" xref: spec_1_neutral_loss_1908_composition "Hex(3) HexNAc(7)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1541 name: dHex(2)Hex(5)HexNAc(4) def: "DHex(2) Hex(5) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1541] xref: record_id "1541" xref: delta_mono_mass "1914.697426" xref: delta_avge_mass "1915.7555" xref: delta_composition "dHex(2) Hex(5) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1915_mono_mass "1914.697426" xref: spec_1_neutral_loss_1915_avge_mass "1915.7555" xref: spec_1_neutral_loss_1915_flag "false" xref: spec_1_neutral_loss_1915_composition "dHex(2) Hex(5) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1542 name: dHex(2)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) def: "DHex(2) Hex(4) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1542] xref: record_id "1542" xref: delta_mono_mass "1920.617461" xref: delta_avge_mass "1921.7401" xref: delta_composition "O(3) S dHex(2) Hex(4) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:38:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1921_mono_mass "1920.617461" xref: spec_1_neutral_loss_1921_avge_mass "1921.7401" xref: spec_1_neutral_loss_1921_flag "false" xref: spec_1_neutral_loss_1921_composition "O(3) S dHex(2) Hex(4) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1543 name: dHex(1)Hex(5)HexNAc(4)Sulf(2) def: "DHex Hex(5) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=1&hex=5&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1543] xref: record_id "1543" xref: delta_mono_mass "1928.553146" xref: delta_avge_mass "1929.7407" xref: delta_composition "O(6) S(2) dHex Hex(5) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:39:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1929_mono_mass "1928.553146" xref: spec_1_neutral_loss_1929_avge_mass "1929.7407" xref: spec_1_neutral_loss_1929_flag "false" xref: spec_1_neutral_loss_1929_composition "O(6) S(2) dHex Hex(5) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1544 name: dHex(1)Hex(5)HexNAc(4)Me(2)Pent(1) def: "DHex Hex(5) HexNAc(4) Me(2) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=4&methyl=2&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1544] xref: record_id "1544" xref: delta_mono_mass "1928.713076" xref: delta_avge_mass "1929.7821" xref: delta_composition "dHex(1) Hex(5) HexNAc(4) Me(2) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1929_mono_mass "1928.713076" xref: spec_1_neutral_loss_1929_avge_mass "1929.7821" xref: spec_1_neutral_loss_1929_flag "false" xref: spec_1_neutral_loss_1929_composition "dHex(1) Hex(5) HexNAc(4) Me(2) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1545 name: Hex(5)HexNAc(4)NeuGc(1) def: "Hex(5) HexNAc(4) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=4&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1545] xref: record_id "1545" xref: delta_mono_mass "1929.671939" xref: delta_avge_mass "1930.7271" xref: delta_composition "Hex(5) HexNAc(4) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1930_mono_mass "1929.671939" xref: spec_1_neutral_loss_1930_avge_mass "1930.7271" xref: spec_1_neutral_loss_1930_flag "false" xref: spec_1_neutral_loss_1930_composition "Hex(5) HexNAc(4) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1546 name: dHex(1)Hex(3)HexNAc(6)Sulf(1) def: "DHex Hex(3) HexNAc(6) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1546] xref: record_id "1546" xref: delta_mono_mass "1930.64943" xref: delta_avge_mass "1931.7813" xref: delta_composition "O(3) S dHex Hex(3) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:39:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1931_mono_mass "1930.64943" xref: spec_1_neutral_loss_1931_avge_mass "1931.7813" xref: spec_1_neutral_loss_1931_flag "false" xref: spec_1_neutral_loss_1931_composition "O(3) S dHex Hex(3) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1547 name: dHex(1)Hex(6)HexNAc(4) def: "DHex Hex(6) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=6&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1547] xref: record_id "1547" xref: delta_mono_mass "1930.69234" xref: delta_avge_mass "1931.7549" xref: delta_composition "dHex(1) Hex(6) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1931_mono_mass "1930.69234" xref: spec_1_neutral_loss_1931_avge_mass "1931.7549" xref: spec_1_neutral_loss_1931_flag "false" xref: spec_1_neutral_loss_1931_composition "dHex(1) Hex(6) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1548 name: dHex(1)Hex(5)HexNAc(3)NeuAc(1)Sulf(1) def: "DHex Hex(5) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1548] xref: record_id "1548" xref: delta_mono_mass "1936.612375" xref: delta_avge_mass "1937.7395" xref: delta_composition "O(3) S dHex Hex(5) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:39:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1937_mono_mass "1936.612375" xref: spec_1_neutral_loss_1937_avge_mass "1937.7395" xref: spec_1_neutral_loss_1937_flag "false" xref: spec_1_neutral_loss_1937_composition "O(3) S dHex Hex(5) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1549 name: Hex(7)HexNAc(4) def: "Hex(7) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1549] xref: record_id "1549" xref: delta_mono_mass "1946.687255" xref: delta_avge_mass "1947.7543" xref: delta_composition "Hex(7) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1947_mono_mass "1946.687255" xref: spec_1_neutral_loss_1947_avge_mass "1947.7543" xref: spec_1_neutral_loss_1947_flag "false" xref: spec_1_neutral_loss_1947_composition "Hex(7) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1550 name: dHex(1)Hex(5)HexNAc(3)NeuGc(1)Sulf(1) def: "DHex Hex(5) HexNAc(3) NeuGc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=5&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1550] xref: record_id "1550" xref: delta_mono_mass "1952.60729" xref: delta_avge_mass "1953.7389" xref: delta_composition "O(3) S dHex Hex(5) HexNAc(3) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:39:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1953_mono_mass "1952.60729" xref: spec_1_neutral_loss_1953_avge_mass "1953.7389" xref: spec_1_neutral_loss_1953_flag "false" xref: spec_1_neutral_loss_1953_composition "O(3) S dHex Hex(5) HexNAc(3) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1551 name: Hex(4)HexNAc(5)NeuAc(1) def: "Hex(4) HexNAc(5) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=5&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1551] xref: record_id "1551" xref: delta_mono_mass "1954.703574" xref: delta_avge_mass "1955.7796" xref: delta_composition "Hex(4) HexNAc(5) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1955_mono_mass "1954.703574" xref: spec_1_neutral_loss_1955_avge_mass "1955.7796" xref: spec_1_neutral_loss_1955_flag "false" xref: spec_1_neutral_loss_1955_composition "Hex(4) HexNAc(5) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1552 name: Hex(6)HexNAc(4)Me(3)Pent(1) def: "Hex(6) HexNAc(4) Me(3) Pent." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=4&methyl=3&pent=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1552] xref: record_id "1552" xref: delta_mono_mass "1958.72364" xref: delta_avge_mass "1959.808" xref: delta_composition "Hex(6) HexNAc(4) Me(3) Pent(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1959_mono_mass "1958.72364" xref: spec_1_neutral_loss_1959_avge_mass "1959.808" xref: spec_1_neutral_loss_1959_flag "false" xref: spec_1_neutral_loss_1959_composition "Hex(6) HexNAc(4) Me(3) Pent(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1553 name: dHex(1)Hex(7)HexNAc(3)Sulf(1) def: "DHex Hex(7) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1553] xref: record_id "1553" xref: delta_mono_mass "1969.622606" xref: delta_avge_mass "1970.7662" xref: delta_composition "O(3) S dHex Hex(7) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:40:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1970_mono_mass "1969.622606" xref: spec_1_neutral_loss_1970_avge_mass "1970.7662" xref: spec_1_neutral_loss_1970_flag "false" xref: spec_1_neutral_loss_1970_composition "O(3) S dHex Hex(7) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1554 name: dHex(1)Hex(7)HexNAc(3)Phos(1) def: "DHex Hex(7) HexNAc(3) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&dhex=1&hex=7&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1554] xref: record_id "1554" xref: delta_mono_mass "1969.632122" xref: delta_avge_mass "1970.6829" xref: delta_composition "H O(3) P dHex Hex(7) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:44:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1970_mono_mass "1969.632122" xref: spec_1_neutral_loss_1970_avge_mass "1970.6829" xref: spec_1_neutral_loss_1970_flag "false" xref: spec_1_neutral_loss_1970_composition "H O(3) P dHex Hex(7) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1555 name: dHex(1)Hex(5)HexNAc(5) def: "DHex Hex(5) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=5&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1555] xref: record_id "1555" xref: delta_mono_mass "1971.718889" xref: delta_avge_mass "1972.8068" xref: delta_composition "dHex(1) Hex(5) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1972_mono_mass "1971.718889" xref: spec_1_neutral_loss_1972_avge_mass "1972.8068" xref: spec_1_neutral_loss_1972_flag "false" xref: spec_1_neutral_loss_1972_composition "dHex(1) Hex(5) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1556 name: dHex(1)Hex(4)HexNAc(4)NeuAc(1)Sulf(1) def: "DHex Hex(4) HexNAc(4) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1556] xref: record_id "1556" xref: delta_mono_mass "1977.638925" xref: delta_avge_mass "1978.7915" xref: delta_composition "O(3) S dHex Hex(4) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:40:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1978_mono_mass "1977.638925" xref: spec_1_neutral_loss_1978_avge_mass "1978.7915" xref: spec_1_neutral_loss_1978_flag "false" xref: spec_1_neutral_loss_1978_composition "O(3) S dHex Hex(4) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1557 name: dHex(3)Hex(4)HexNAc(4)Sulf(1) def: "DHex(3) Hex(4) HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=3&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1557] xref: record_id "1557" xref: delta_mono_mass "1978.659326" xref: delta_avge_mass "1979.8193" xref: delta_composition "O(3) S dHex(3) Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:40:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1979_mono_mass "1978.659326" xref: spec_1_neutral_loss_1979_avge_mass "1979.8193" xref: spec_1_neutral_loss_1979_flag "false" xref: spec_1_neutral_loss_1979_composition "O(3) S dHex(3) Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1558 name: Hex(3)HexNAc(7)Sulf(1) def: "Hex(3) HexNAc(7) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1558] xref: record_id "1558" xref: delta_mono_mass "1987.670893" xref: delta_avge_mass "1988.8326" xref: delta_composition "O(3) S Hex(3) HexNAc(7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:40:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1988_mono_mass "1987.670893" xref: spec_1_neutral_loss_1988_avge_mass "1988.8326" xref: spec_1_neutral_loss_1988_flag "false" xref: spec_1_neutral_loss_1988_composition "O(3) S Hex(3) HexNAc(7)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1559 name: Hex(6)HexNAc(5) def: "A3G3." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1559] xref: record_id "1559" xref: delta_mono_mass "1987.713804" xref: delta_avge_mass "1988.8062" xref: delta_composition "Hex(6) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:45:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1988_mono_mass "1987.713804" xref: spec_1_neutral_loss_1988_avge_mass "1988.8062" xref: spec_1_neutral_loss_1988_flag "false" xref: spec_1_neutral_loss_1988_composition "Hex(6) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1560 name: Hex(5)HexNAc(4)NeuAc(1)Sulf(1) def: "Hex(5) HexNAc(4) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1560] xref: record_id "1560" xref: delta_mono_mass "1993.633839" xref: delta_avge_mass "1994.7909" xref: delta_composition "O(3) S Hex(5) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:40:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1994_mono_mass "1993.633839" xref: spec_1_neutral_loss_1994_avge_mass "1994.7909" xref: spec_1_neutral_loss_1994_flag "false" xref: spec_1_neutral_loss_1994_composition "O(3) S Hex(5) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1561 name: Hex(3)HexNAc(6)NeuAc(1) def: "Hex(3) HexNAc(6) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=6&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1561] xref: record_id "1561" xref: delta_mono_mass "1995.730123" xref: delta_avge_mass "1996.8315" xref: delta_composition "Hex(3) HexNAc(6) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1996_mono_mass "1995.730123" xref: spec_1_neutral_loss_1996_avge_mass "1996.8315" xref: spec_1_neutral_loss_1996_flag "false" xref: spec_1_neutral_loss_1996_composition "Hex(3) HexNAc(6) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1562 name: dHex(2)Hex(3)HexNAc(6) def: "DHex(2) Hex(3) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1562] xref: record_id "1562" xref: delta_mono_mass "1996.750524" xref: delta_avge_mass "1997.8593" xref: delta_composition "dHex(2) Hex(3) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1997_mono_mass "1996.750524" xref: spec_1_neutral_loss_1997_avge_mass "1997.8593" xref: spec_1_neutral_loss_1997_flag "false" xref: spec_1_neutral_loss_1997_composition "dHex(2) Hex(3) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1563 name: Hex(1)HexNAc(1)NeuGc(1) def: "Hex HexNAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1563] xref: record_id "1563" xref: delta_mono_mass "672.222527" xref: delta_avge_mass "672.5871" xref: delta_composition "Hex(1) HexNAc(1) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_673_mono_mass "672.222527" xref: spec_1_neutral_loss_673_avge_mass "672.5871" xref: spec_1_neutral_loss_673_flag "false" xref: spec_1_neutral_loss_673_composition "Hex(1) HexNAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_673_mono_mass "672.222527" xref: spec_1_neutral_loss_673_avge_mass "672.5871" xref: spec_1_neutral_loss_673_flag "false" xref: spec_1_neutral_loss_673_composition "Hex(1) HexNAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1564 name: dHex(1)Hex(2)HexNAc(1) def: "DHex Hex(2) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1564] xref: record_id "1564" xref: delta_mono_mass "673.242928" xref: delta_avge_mass "673.6149" xref: delta_composition "dHex(1) Hex(2) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_674_mono_mass "673.242928" xref: spec_1_neutral_loss_674_avge_mass "673.6149" xref: spec_1_neutral_loss_674_flag "false" xref: spec_1_neutral_loss_674_composition "dHex(1) Hex(2) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_674_mono_mass "673.242928" xref: spec_1_neutral_loss_674_avge_mass "673.6149" xref: spec_1_neutral_loss_674_flag "false" xref: spec_1_neutral_loss_674_composition "dHex(1) Hex(2) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1565 name: HexNAc(3)Sulf(1) def: "HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1565] xref: record_id "1565" xref: delta_mono_mass "689.194932" xref: delta_avge_mass "689.6408" xref: delta_composition "O(3) S HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:26:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_690_mono_mass "689.194932" xref: spec_1_neutral_loss_690_avge_mass "689.6408" xref: spec_1_neutral_loss_690_flag "false" xref: spec_1_neutral_loss_690_composition "O(3) S HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_690_mono_mass "689.194932" xref: spec_1_neutral_loss_690_avge_mass "689.6408" xref: spec_1_neutral_loss_690_flag "false" xref: spec_1_neutral_loss_690_composition "O(3) S HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1566 name: Hex(3)HexNAc(1) def: "Hex(3) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1566] xref: record_id "1566" xref: delta_mono_mass "689.237843" xref: delta_avge_mass "689.6143" xref: delta_composition "Hex(3) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-23 17:47:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_690_mono_mass "689.237843" xref: spec_1_neutral_loss_690_avge_mass "689.6143" xref: spec_1_neutral_loss_690_flag "false" xref: spec_1_neutral_loss_690_composition "Hex(3) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_690_mono_mass "689.237843" xref: spec_1_neutral_loss_690_avge_mass "689.6143" xref: spec_1_neutral_loss_690_flag "false" xref: spec_1_neutral_loss_690_composition "Hex(3) HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_690_mono_mass "689.237843" xref: spec_2_neutral_loss_690_avge_mass "689.6143" xref: spec_2_neutral_loss_690_flag "false" xref: spec_2_neutral_loss_690_composition "Hex(3) HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1567 name: Hex(1)HexNAc(1)Kdn(1)Sulf(1) def: "Hex HexNAc Kdn Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=1&kdn=1)mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1567] xref: record_id "1567" xref: delta_mono_mass "695.157878" xref: delta_avge_mass "695.599" xref: delta_composition "O(3) S Hex HexNAc Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:26:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_696_mono_mass "695.157878" xref: spec_1_neutral_loss_696_avge_mass "695.599" xref: spec_1_neutral_loss_696_flag "false" xref: spec_1_neutral_loss_696_composition "O(3) S Hex HexNAc Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_696_mono_mass "695.157878" xref: spec_1_neutral_loss_696_avge_mass "695.599" xref: spec_1_neutral_loss_696_flag "false" xref: spec_1_neutral_loss_696_composition "O(3) S Hex HexNAc Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1568 name: HexNAc(2)NeuAc(1) def: "HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1568] xref: record_id "1568" xref: delta_mono_mass "697.254162" xref: delta_avge_mass "697.6396" xref: delta_composition "HexNAc(2) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_698_mono_mass "697.254162" xref: spec_1_neutral_loss_698_avge_mass "697.6396" xref: spec_1_neutral_loss_698_flag "false" xref: spec_1_neutral_loss_698_composition "HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_698_mono_mass "697.254162" xref: spec_1_neutral_loss_698_avge_mass "697.6396" xref: spec_1_neutral_loss_698_flag "false" xref: spec_1_neutral_loss_698_composition "HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1570 name: HexNAc(1)Kdn(2) def: "HexNAc Kdn(2) ---OR--- Hex(2) HexNAc HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&kdn=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1570] xref: record_id "1570" xref: delta_mono_mass "703.217108" xref: delta_avge_mass "703.5978" xref: delta_composition "HexNAc Kdn(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 11:43:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_704_mono_mass "703.217108" xref: spec_1_neutral_loss_704_avge_mass "703.5978" xref: spec_1_neutral_loss_704_flag "false" xref: spec_1_neutral_loss_704_composition "HexNAc Kdn(2)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_704_mono_mass "703.217108" xref: spec_1_neutral_loss_704_avge_mass "703.5978" xref: spec_1_neutral_loss_704_flag "false" xref: spec_1_neutral_loss_704_composition "HexNAc Kdn(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1571 name: Hex(3)HexNAc(1)Me(1) def: "Hex(3) HexNAc Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=1&methyl=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1571] xref: record_id "1571" xref: delta_mono_mass "703.253493" xref: delta_avge_mass "703.6409" xref: delta_composition "Hex(3) HexNAc(1) Me(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_704_mono_mass "703.253493" xref: spec_1_neutral_loss_704_avge_mass "703.6409" xref: spec_1_neutral_loss_704_flag "false" xref: spec_1_neutral_loss_704_composition "Hex(3) HexNAc(1) Me(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_704_mono_mass "703.253493" xref: spec_1_neutral_loss_704_avge_mass "703.6409" xref: spec_1_neutral_loss_704_flag "false" xref: spec_1_neutral_loss_704_composition "Hex(3) HexNAc(1) Me(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1572 name: Hex(2)HexA(1)Pent(1)Sulf(1) def: "Hex(2) HexA Pent Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&pent=1&hex=2&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1572] xref: record_id "1572" xref: delta_mono_mass "712.136808" xref: delta_avge_mass "712.5831" xref: delta_composition "O(3) S Pent Hex(2) HexA" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:27:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_713_mono_mass "712.136808" xref: spec_1_neutral_loss_713_avge_mass "712.5831" xref: spec_1_neutral_loss_713_flag "false" xref: spec_1_neutral_loss_713_composition "O(3) S Pent Hex(2) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_713_mono_mass "712.136808" xref: spec_1_neutral_loss_713_avge_mass "712.5831" xref: spec_1_neutral_loss_713_flag "false" xref: spec_1_neutral_loss_713_composition "O(3) S Pent Hex(2) HexA" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1573 name: HexNAc(2)NeuGc(1) def: "HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1573] xref: record_id "1573" xref: delta_mono_mass "713.249076" xref: delta_avge_mass "713.639" xref: delta_composition "HexNAc(2) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_714_mono_mass "713.249076" xref: spec_1_neutral_loss_714_avge_mass "713.639" xref: spec_1_neutral_loss_714_flag "false" xref: spec_1_neutral_loss_714_composition "HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_714_mono_mass "713.249076" xref: spec_1_neutral_loss_714_avge_mass "713.639" xref: spec_1_neutral_loss_714_flag "false" xref: spec_1_neutral_loss_714_composition "HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1575 name: Hex(4)Phos(1) def: "Hex(4) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1575] xref: record_id "1575" xref: delta_mono_mass "728.177625" xref: delta_avge_mass "728.5423" xref: delta_composition "H O(3) P Hex(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:42:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_729_mono_mass "728.177625" xref: spec_1_neutral_loss_729_avge_mass "728.5423" xref: spec_1_neutral_loss_729_flag "false" xref: spec_1_neutral_loss_729_composition "H O(3) P Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_729_mono_mass "728.177625" xref: spec_1_neutral_loss_729_avge_mass "728.5423" xref: spec_1_neutral_loss_729_flag "false" xref: spec_1_neutral_loss_729_composition "H O(3) P Hex(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1577 name: Hex(1)HexNAc(1)NeuAc(1)Sulf(1) def: "Hex HexNAc NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1577] xref: record_id "1577" xref: delta_mono_mass "736.184427" xref: delta_avge_mass "736.6509" xref: delta_composition "O(3) S Hex HexNAc NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:27:24" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_737_mono_mass "736.184427" xref: spec_1_neutral_loss_737_avge_mass "736.6509" xref: spec_1_neutral_loss_737_flag "false" xref: spec_1_neutral_loss_737_composition "O(3) S Hex HexNAc NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_737_mono_mass "736.184427" xref: spec_1_neutral_loss_737_avge_mass "736.6509" xref: spec_1_neutral_loss_737_flag "false" xref: spec_1_neutral_loss_737_composition "O(3) S Hex HexNAc NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1578 name: Hex(1)HexA(1)HexNAc(2) def: "Hex HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1578] xref: record_id "1578" xref: delta_mono_mass "744.243657" xref: delta_avge_mass "744.6498" xref: delta_composition "Hex(1) HexA(1) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_745_mono_mass "744.243657" xref: spec_1_neutral_loss_745_avge_mass "744.6498" xref: spec_1_neutral_loss_745_flag "false" xref: spec_1_neutral_loss_745_composition "Hex(1) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_745_mono_mass "744.243657" xref: spec_1_neutral_loss_745_avge_mass "744.6498" xref: spec_1_neutral_loss_745_flag "false" xref: spec_1_neutral_loss_745_composition "Hex(1) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1579 name: dHex(1)Hex(2)HexNAc(1)Sulf(1) def: "DHex Hex(2) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1579] xref: record_id "1579" xref: delta_mono_mass "753.199743" xref: delta_avge_mass "753.6781" xref: delta_composition "O(3) S dHex Hex(2) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:27:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_754_mono_mass "753.199743" xref: spec_1_neutral_loss_754_avge_mass "753.6781" xref: spec_1_neutral_loss_754_flag "false" xref: spec_1_neutral_loss_754_composition "O(3) S dHex Hex(2) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_754_mono_mass "753.199743" xref: spec_1_neutral_loss_754_avge_mass "753.6781" xref: spec_1_neutral_loss_754_flag "false" xref: spec_1_neutral_loss_754_composition "O(3) S dHex Hex(2) HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1580 name: dHex(1)HexNAc(3) def: "DHex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1580] xref: record_id "1580" xref: delta_mono_mass "755.296027" xref: delta_avge_mass "755.7188" xref: delta_composition "dHex(1) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_756_mono_mass "755.296027" xref: spec_1_neutral_loss_756_avge_mass "755.7188" xref: spec_1_neutral_loss_756_flag "false" xref: spec_1_neutral_loss_756_composition "dHex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_756_mono_mass "755.296027" xref: spec_1_neutral_loss_756_avge_mass "755.7188" xref: spec_1_neutral_loss_756_flag "false" xref: spec_1_neutral_loss_756_composition "dHex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1581 name: dHex(1)Hex(1)HexNAc(1)Kdn(1) def: "DHex Hex HexNAc Kdn ---OR--- Hex(2) dHex NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1581] xref: record_id "1581" xref: delta_mono_mass "761.258973" xref: delta_avge_mass "761.677" xref: delta_composition "dHex Hex HexNAc Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 11:43:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_762_mono_mass "761.258973" xref: spec_1_neutral_loss_762_avge_mass "761.677" xref: spec_1_neutral_loss_762_flag "false" xref: spec_1_neutral_loss_762_composition "dHex Hex HexNAc Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_762_mono_mass "761.258973" xref: spec_1_neutral_loss_762_avge_mass "761.677" xref: spec_1_neutral_loss_762_flag "false" xref: spec_1_neutral_loss_762_composition "dHex Hex HexNAc Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1582 name: Hex(1)HexNAc(3) def: "Hex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1582] xref: record_id "1582" xref: delta_mono_mass "771.290941" xref: delta_avge_mass "771.7182" xref: delta_composition "Hex(1) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_772_mono_mass "771.290941" xref: spec_1_neutral_loss_772_avge_mass "771.7182" xref: spec_1_neutral_loss_772_flag "false" xref: spec_1_neutral_loss_772_composition "Hex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_772_mono_mass "771.290941" xref: spec_1_neutral_loss_772_avge_mass "771.7182" xref: spec_1_neutral_loss_772_flag "false" xref: spec_1_neutral_loss_772_composition "Hex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1583 name: HexNAc(2)NeuAc(1)Sulf(1) def: "HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1583] xref: record_id "1583" xref: delta_mono_mass "777.210976" xref: delta_avge_mass "777.7028" xref: delta_composition "O(3) S HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:27:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_778_mono_mass "777.210976" xref: spec_1_neutral_loss_778_avge_mass "777.7028" xref: spec_1_neutral_loss_778_flag "false" xref: spec_1_neutral_loss_778_composition "O(3) S HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_778_mono_mass "777.210976" xref: spec_1_neutral_loss_778_avge_mass "777.7028" xref: spec_1_neutral_loss_778_flag "false" xref: spec_1_neutral_loss_778_composition "O(3) S HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1584 name: dHex(2)Hex(3) def: "DHex(2) Hex(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1584] xref: record_id "1584" xref: delta_mono_mass "778.274288" xref: delta_avge_mass "778.7042" xref: delta_composition "dHex(2) Hex(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_779_mono_mass "778.274288" xref: spec_1_neutral_loss_779_avge_mass "778.7042" xref: spec_1_neutral_loss_779_flag "false" xref: spec_1_neutral_loss_779_composition "dHex(2) Hex(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_779_mono_mass "778.274288" xref: spec_1_neutral_loss_779_avge_mass "778.7042" xref: spec_1_neutral_loss_779_flag "false" xref: spec_1_neutral_loss_779_composition "dHex(2) Hex(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1585 name: Hex(2)HexA(1)HexNAc(1)Sulf(1) def: "Hex(2) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1585] xref: record_id "1585" xref: delta_mono_mass "783.173922" xref: delta_avge_mass "783.661" xref: delta_composition "O(3) S Hex(2) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:28:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_784_mono_mass "783.173922" xref: spec_1_neutral_loss_784_avge_mass "783.661" xref: spec_1_neutral_loss_784_flag "false" xref: spec_1_neutral_loss_784_composition "O(3) S Hex(2) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_784_mono_mass "783.173922" xref: spec_1_neutral_loss_784_avge_mass "783.661" xref: spec_1_neutral_loss_784_flag "false" xref: spec_1_neutral_loss_784_composition "O(3) S Hex(2) HexA HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1586 name: dHex(2)Hex(2)HexA(1) def: "DHex(2) Hex(2) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1586] xref: record_id "1586" xref: delta_mono_mass "792.253553" xref: delta_avge_mass "792.6877" xref: delta_composition "dHex(2) Hex(2) HexA(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_793_mono_mass "792.253553" xref: spec_1_neutral_loss_793_avge_mass "792.6877" xref: spec_1_neutral_loss_793_flag "false" xref: spec_1_neutral_loss_793_composition "dHex(2) Hex(2) HexA(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_793_mono_mass "792.253553" xref: spec_1_neutral_loss_793_avge_mass "792.6877" xref: spec_1_neutral_loss_793_flag "false" xref: spec_1_neutral_loss_793_composition "dHex(2) Hex(2) HexA(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1587 name: dHex(1)Hex(1)HexNAc(2)Sulf(1) def: "DHex Hex HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1587] xref: record_id "1587" xref: delta_mono_mass "794.226292" xref: delta_avge_mass "794.73" xref: delta_composition "O(3) S dHex Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:28:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_795_mono_mass "794.226292" xref: spec_1_neutral_loss_795_avge_mass "794.73" xref: spec_1_neutral_loss_795_flag "false" xref: spec_1_neutral_loss_795_composition "O(3) S dHex Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_795_mono_mass "794.226292" xref: spec_1_neutral_loss_795_avge_mass "794.73" xref: spec_1_neutral_loss_795_flag "false" xref: spec_1_neutral_loss_795_composition "O(3) S dHex Hex HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1588 name: dHex(1)Hex(1)HexNAc(1)NeuAc(1) def: "DHex Hex HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1588] xref: record_id "1588" xref: delta_mono_mass "802.285522" xref: delta_avge_mass "802.7289" xref: delta_composition "dHex(1) Hex(1) HexNAc(1) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_803_mono_mass "802.285522" xref: spec_1_neutral_loss_803_avge_mass "802.7289" xref: spec_1_neutral_loss_803_flag "false" xref: spec_1_neutral_loss_803_composition "dHex(1) Hex(1) HexNAc(1) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_803_mono_mass "802.285522" xref: spec_1_neutral_loss_803_avge_mass "802.7289" xref: spec_1_neutral_loss_803_flag "false" xref: spec_1_neutral_loss_803_composition "dHex(1) Hex(1) HexNAc(1) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1589 name: Hex(2)HexNAc(2)Sulf(1) def: "Hex(2) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1589] xref: record_id "1589" xref: delta_mono_mass "810.221207" xref: delta_avge_mass "810.7294" xref: delta_composition "O(3) S Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:28:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_811_mono_mass "810.221207" xref: spec_1_neutral_loss_811_avge_mass "810.7294" xref: spec_1_neutral_loss_811_flag "false" xref: spec_1_neutral_loss_811_composition "O(3) S Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_811_mono_mass "810.221207" xref: spec_1_neutral_loss_811_avge_mass "810.7294" xref: spec_1_neutral_loss_811_flag "false" xref: spec_1_neutral_loss_811_composition "O(3) S Hex(2) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1590 name: Hex(5) def: "Hex(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1590] xref: record_id "1590" xref: delta_mono_mass "810.264117" xref: delta_avge_mass "810.703" xref: delta_composition "Hex(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_811_mono_mass "810.264117" xref: spec_1_neutral_loss_811_avge_mass "810.703" xref: spec_1_neutral_loss_811_flag "false" xref: spec_1_neutral_loss_811_composition "Hex(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_811_mono_mass "810.264117" xref: spec_1_neutral_loss_811_avge_mass "810.703" xref: spec_1_neutral_loss_811_flag "false" xref: spec_1_neutral_loss_811_composition "Hex(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1591 name: HexNAc(4) def: "HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1591] xref: record_id "1591" xref: delta_mono_mass "812.31749" xref: delta_avge_mass "812.7701" xref: delta_composition "HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_813_mono_mass "812.31749" xref: spec_1_neutral_loss_813_avge_mass "812.7701" xref: spec_1_neutral_loss_813_flag "false" xref: spec_1_neutral_loss_813_composition "HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_813_mono_mass "812.31749" xref: spec_1_neutral_loss_813_avge_mass "812.7701" xref: spec_1_neutral_loss_813_flag "false" xref: spec_1_neutral_loss_813_composition "HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1592 name: HexNAc(1)NeuGc(2) def: "HexNAc NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=1&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1592] xref: record_id "1592" xref: delta_mono_mass "817.260035" xref: delta_avge_mass "817.7005" xref: delta_composition "HexNAc(1) NeuGc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_818_mono_mass "817.260035" xref: spec_1_neutral_loss_818_avge_mass "817.7005" xref: spec_1_neutral_loss_818_flag "false" xref: spec_1_neutral_loss_818_composition "HexNAc(1) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_818_mono_mass "817.260035" xref: spec_1_neutral_loss_818_avge_mass "817.7005" xref: spec_1_neutral_loss_818_flag "false" xref: spec_1_neutral_loss_818_composition "HexNAc(1) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1593 name: dHex(1)Hex(1)HexNAc(1)NeuGc(1) def: "DHex Hex HexNAc NeuGc ---OR--- Hex(2) HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1593] xref: record_id "1593" xref: delta_mono_mass "818.280436" xref: delta_avge_mass "818.7283" xref: delta_composition "dHex Hex HexNAc NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 11:43:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_819_mono_mass "818.280436" xref: spec_1_neutral_loss_819_avge_mass "818.7283" xref: spec_1_neutral_loss_819_flag "false" xref: spec_1_neutral_loss_819_composition "dHex Hex HexNAc NeuGc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_819_mono_mass "818.280436" xref: spec_1_neutral_loss_819_avge_mass "818.7283" xref: spec_1_neutral_loss_819_flag "false" xref: spec_1_neutral_loss_819_composition "dHex Hex HexNAc NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1594 name: dHex(2)Hex(2)HexNAc(1) def: "DHex(2) Hex(2) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1594] xref: record_id "1594" xref: delta_mono_mass "819.300837" xref: delta_avge_mass "819.7561" xref: delta_composition "dHex(2) Hex(2) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_820_mono_mass "819.300837" xref: spec_1_neutral_loss_820_avge_mass "819.7561" xref: spec_1_neutral_loss_820_flag "false" xref: spec_1_neutral_loss_820_composition "dHex(2) Hex(2) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_820_mono_mass "819.300837" xref: spec_1_neutral_loss_820_avge_mass "819.7561" xref: spec_1_neutral_loss_820_flag "false" xref: spec_1_neutral_loss_820_composition "dHex(2) Hex(2) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1595 name: Hex(2)HexNAc(1)NeuGc(1) def: "Hex(2) HexNAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1595] xref: record_id "1595" xref: delta_mono_mass "834.275351" xref: delta_avge_mass "834.7277" xref: delta_composition "Hex(2) HexNAc(1) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_835_mono_mass "834.275351" xref: spec_1_neutral_loss_835_avge_mass "834.7277" xref: spec_1_neutral_loss_835_flag "false" xref: spec_1_neutral_loss_835_composition "Hex(2) HexNAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_835_mono_mass "834.275351" xref: spec_1_neutral_loss_835_avge_mass "834.7277" xref: spec_1_neutral_loss_835_flag "false" xref: spec_1_neutral_loss_835_composition "Hex(2) HexNAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1596 name: dHex(1)Hex(3)HexNAc(1) def: "DHex Hex(3) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1596] xref: record_id "1596" xref: delta_mono_mass "835.295752" xref: delta_avge_mass "835.7555" xref: delta_composition "dHex(1) Hex(3) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_836_mono_mass "835.295752" xref: spec_1_neutral_loss_836_avge_mass "835.7555" xref: spec_1_neutral_loss_836_flag "false" xref: spec_1_neutral_loss_836_composition "dHex(1) Hex(3) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_836_mono_mass "835.295752" xref: spec_1_neutral_loss_836_avge_mass "835.7555" xref: spec_1_neutral_loss_836_flag "false" xref: spec_1_neutral_loss_836_composition "dHex(1) Hex(3) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1597 name: dHex(1)Hex(2)HexA(1)HexNAc(1) def: "DHex Hex(2) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1597] xref: record_id "1597" xref: delta_mono_mass "849.275017" xref: delta_avge_mass "849.739" xref: delta_composition "dHex(1) Hex(2) HexA(1) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_850_mono_mass "849.275017" xref: spec_1_neutral_loss_850_avge_mass "849.739" xref: spec_1_neutral_loss_850_flag "false" xref: spec_1_neutral_loss_850_composition "dHex(1) Hex(2) HexA(1) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_850_mono_mass "849.275017" xref: spec_1_neutral_loss_850_avge_mass "849.739" xref: spec_1_neutral_loss_850_flag "false" xref: spec_1_neutral_loss_850_composition "dHex(1) Hex(2) HexA(1) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1598 name: Hex(1)HexNAc(3)Sulf(1) def: "Hex HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1598] xref: record_id "1598" xref: delta_mono_mass "851.247756" xref: delta_avge_mass "851.7814" xref: delta_composition "O(3) S Hex HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:28:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_852_mono_mass "851.247756" xref: spec_1_neutral_loss_852_avge_mass "851.7814" xref: spec_1_neutral_loss_852_flag "false" xref: spec_1_neutral_loss_852_composition "O(3) S Hex HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_852_mono_mass "851.247756" xref: spec_1_neutral_loss_852_avge_mass "851.7814" xref: spec_1_neutral_loss_852_flag "false" xref: spec_1_neutral_loss_852_composition "O(3) S Hex HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1599 name: Hex(4)HexNAc(1) def: "Hex(4) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1599] xref: record_id "1599" xref: delta_mono_mass "851.290667" xref: delta_avge_mass "851.7549" xref: delta_composition "Hex(4) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 10:39:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_852_mono_mass "851.290667" xref: spec_1_neutral_loss_852_avge_mass "851.7549" xref: spec_1_neutral_loss_852_flag "false" xref: spec_1_neutral_loss_852_composition "Hex(4) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_852_mono_mass "851.290667" xref: spec_1_neutral_loss_852_avge_mass "851.7549" xref: spec_1_neutral_loss_852_flag "false" xref: spec_1_neutral_loss_852_composition "Hex(4) HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_852_mono_mass "851.290667" xref: spec_2_neutral_loss_852_avge_mass "851.7549" xref: spec_2_neutral_loss_852_flag "false" xref: spec_2_neutral_loss_852_composition "Hex(4) HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1600 name: Hex(1)HexNAc(2)NeuAc(1) def: "Hex HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1600] xref: record_id "1600" xref: delta_mono_mass "859.306985" xref: delta_avge_mass "859.7802" xref: delta_composition "Hex(1) HexNAc(2) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_860_mono_mass "859.306985" xref: spec_1_neutral_loss_860_avge_mass "859.7802" xref: spec_1_neutral_loss_860_flag "false" xref: spec_1_neutral_loss_860_composition "Hex(1) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_860_mono_mass "859.306985" xref: spec_1_neutral_loss_860_avge_mass "859.7802" xref: spec_1_neutral_loss_860_flag "false" xref: spec_1_neutral_loss_860_composition "Hex(1) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1602 name: Hex(1)HexNAc(2)NeuGc(1) def: "Hex HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1602] xref: record_id "1602" xref: delta_mono_mass "875.3019" xref: delta_avge_mass "875.7796" xref: delta_composition "Hex(1) HexNAc(2) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_876_mono_mass "875.3019" xref: spec_1_neutral_loss_876_avge_mass "875.7796" xref: spec_1_neutral_loss_876_flag "false" xref: spec_1_neutral_loss_876_composition "Hex(1) HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_876_mono_mass "875.3019" xref: spec_1_neutral_loss_876_avge_mass "875.7796" xref: spec_1_neutral_loss_876_flag "false" xref: spec_1_neutral_loss_876_composition "Hex(1) HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1604 name: Hex(5)Phos(1) def: "Hex(5) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1604] xref: record_id "1604" xref: delta_mono_mass "890.230448" xref: delta_avge_mass "890.6829" xref: delta_composition "H O(3) P Hex(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:42:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_891_mono_mass "890.230448" xref: spec_1_neutral_loss_891_avge_mass "890.6829" xref: spec_1_neutral_loss_891_flag "false" xref: spec_1_neutral_loss_891_composition "H O(3) P Hex(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_891_mono_mass "890.230448" xref: spec_1_neutral_loss_891_avge_mass "890.6829" xref: spec_1_neutral_loss_891_flag "false" xref: spec_1_neutral_loss_891_composition "H O(3) P Hex(5)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1606 name: dHex(2)Hex(1)HexNAc(1)Kdn(1) def: "DHex(2) Hex HexNAc Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=1&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1606] xref: record_id "1606" xref: delta_mono_mass "907.316881" xref: delta_avge_mass "907.8182" xref: delta_composition "dHex(2) Hex HexNAc Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:57:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_908_mono_mass "907.316881" xref: spec_1_neutral_loss_908_avge_mass "907.8182" xref: spec_1_neutral_loss_908_flag "false" xref: spec_1_neutral_loss_908_composition "dHex(2) Hex HexNAc Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_908_mono_mass "907.316881" xref: spec_1_neutral_loss_908_avge_mass "907.8182" xref: spec_1_neutral_loss_908_flag "false" xref: spec_1_neutral_loss_908_composition "dHex(2) Hex HexNAc Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1607 name: dHex(1)Hex(3)HexNAc(1)Sulf(1) def: "DHex Hex(3) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1607] xref: record_id "1607" xref: delta_mono_mass "915.252567" xref: delta_avge_mass "915.8187" xref: delta_composition "O(3) S dHex Hex(3) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:28:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_916_mono_mass "915.252567" xref: spec_1_neutral_loss_916_avge_mass "915.8187" xref: spec_1_neutral_loss_916_flag "false" xref: spec_1_neutral_loss_916_composition "O(3) S dHex Hex(3) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_916_mono_mass "915.252567" xref: spec_1_neutral_loss_916_avge_mass "915.8187" xref: spec_1_neutral_loss_916_flag "false" xref: spec_1_neutral_loss_916_composition "O(3) S dHex Hex(3) HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1608 name: dHex(1)Hex(1)HexNAc(3) def: "DHex Hex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1608] xref: record_id "1608" xref: delta_mono_mass "917.34885" xref: delta_avge_mass "917.8594" xref: delta_composition "dHex(1) Hex(1) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_918_mono_mass "917.34885" xref: spec_1_neutral_loss_918_avge_mass "917.8594" xref: spec_1_neutral_loss_918_flag "false" xref: spec_1_neutral_loss_918_composition "dHex(1) Hex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_918_mono_mass "917.34885" xref: spec_1_neutral_loss_918_avge_mass "917.8594" xref: spec_1_neutral_loss_918_flag "false" xref: spec_1_neutral_loss_918_composition "dHex(1) Hex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1609 name: dHex(1)Hex(2)HexA(1)HexNAc(1)Sulf(1) def: "DHex Hex(2) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1609] xref: record_id "1609" xref: delta_mono_mass "929.231831" xref: delta_avge_mass "929.8022" xref: delta_composition "O(3) S dHex Hex(2) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:28:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_930_mono_mass "929.231831" xref: spec_1_neutral_loss_930_avge_mass "929.8022" xref: spec_1_neutral_loss_930_flag "false" xref: spec_1_neutral_loss_930_composition "O(3) S dHex Hex(2) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_930_mono_mass "929.231831" xref: spec_1_neutral_loss_930_avge_mass "929.8022" xref: spec_1_neutral_loss_930_flag "false" xref: spec_1_neutral_loss_930_composition "O(3) S dHex Hex(2) HexA HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1610 name: Hex(2)HexNAc(3) def: "Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1610] xref: record_id "1610" xref: delta_mono_mass "933.343765" xref: delta_avge_mass "933.8588" xref: delta_composition "Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 10:43:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_934_mono_mass "933.343765" xref: spec_1_neutral_loss_934_avge_mass "933.8588" xref: spec_1_neutral_loss_934_flag "false" xref: spec_1_neutral_loss_934_composition "Hex(2) HexNAc(3)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_934_mono_mass "933.343765" xref: spec_1_neutral_loss_934_avge_mass "933.8588" xref: spec_1_neutral_loss_934_flag "false" xref: spec_1_neutral_loss_934_composition "Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_934_mono_mass "933.343765" xref: spec_2_neutral_loss_934_avge_mass "933.8588" xref: spec_2_neutral_loss_934_flag "false" xref: spec_2_neutral_loss_934_composition "Hex(2) HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1611 name: Hex(1)HexNAc(2)NeuAc(1)Sulf(1) def: "Hex HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1611] xref: record_id "1611" xref: delta_mono_mass "939.2638" xref: delta_avge_mass "939.8434" xref: delta_composition "O(3) S Hex HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:29:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_940_mono_mass "939.2638" xref: spec_1_neutral_loss_940_avge_mass "939.8434" xref: spec_1_neutral_loss_940_flag "false" xref: spec_1_neutral_loss_940_composition "O(3) S Hex HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_940_mono_mass "939.2638" xref: spec_1_neutral_loss_940_avge_mass "939.8434" xref: spec_1_neutral_loss_940_flag "false" xref: spec_1_neutral_loss_940_composition "O(3) S Hex HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1612 name: dHex(2)Hex(4) def: "DHex(2) Hex(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1612] xref: record_id "1612" xref: delta_mono_mass "940.327112" xref: delta_avge_mass "940.8448" xref: delta_composition "dHex(2) Hex(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_941_mono_mass "940.327112" xref: spec_1_neutral_loss_941_avge_mass "940.8448" xref: spec_1_neutral_loss_941_flag "false" xref: spec_1_neutral_loss_941_composition "dHex(2) Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_941_mono_mass "940.327112" xref: spec_1_neutral_loss_941_avge_mass "940.8448" xref: spec_1_neutral_loss_941_flag "false" xref: spec_1_neutral_loss_941_composition "dHex(2) Hex(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1614 name: dHex(2)HexNAc(2)Kdn(1) def: "DHex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1614] xref: record_id "1614" xref: delta_mono_mass "948.34343" xref: delta_avge_mass "948.8701" xref: delta_composition "dHex(2) HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:57:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_949_mono_mass "948.34343" xref: spec_1_neutral_loss_949_avge_mass "948.8701" xref: spec_1_neutral_loss_949_flag "false" xref: spec_1_neutral_loss_949_composition "dHex(2) HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_949_mono_mass "948.34343" xref: spec_1_neutral_loss_949_avge_mass "948.8701" xref: spec_1_neutral_loss_949_flag "false" xref: spec_1_neutral_loss_949_composition "dHex(2) HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1615 name: dHex(1)Hex(2)HexNAc(2)Sulf(1) def: "DHex Hex(2) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1615] xref: record_id "1615" xref: delta_mono_mass "956.279116" xref: delta_avge_mass "956.8706" xref: delta_composition "O(3) S dHex Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:29:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_957_mono_mass "956.279116" xref: spec_1_neutral_loss_957_avge_mass "956.8706" xref: spec_1_neutral_loss_957_flag "false" xref: spec_1_neutral_loss_957_composition "O(3) S dHex Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_957_mono_mass "956.279116" xref: spec_1_neutral_loss_957_avge_mass "956.8706" xref: spec_1_neutral_loss_957_flag "false" xref: spec_1_neutral_loss_957_composition "O(3) S dHex Hex(2) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1616 name: dHex(1)HexNAc(4) def: "DHex HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1616] xref: record_id "1616" xref: delta_mono_mass "958.375399" xref: delta_avge_mass "958.9113" xref: delta_composition "dHex(1) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_959_mono_mass "958.375399" xref: spec_1_neutral_loss_959_avge_mass "958.9113" xref: spec_1_neutral_loss_959_flag "false" xref: spec_1_neutral_loss_959_composition "dHex(1) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_959_mono_mass "958.375399" xref: spec_1_neutral_loss_959_avge_mass "958.9113" xref: spec_1_neutral_loss_959_flag "false" xref: spec_1_neutral_loss_959_composition "dHex(1) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1617 name: Hex(1)HexNAc(1)NeuAc(1)NeuGc(1) def: "Hex HexNAc NeuAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1617] xref: record_id "1617" xref: delta_mono_mass "963.317944" xref: delta_avge_mass "963.8417" xref: delta_composition "Hex(1) HexNAc(1) NeuAc(1) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_964_mono_mass "963.317944" xref: spec_1_neutral_loss_964_avge_mass "963.8417" xref: spec_1_neutral_loss_964_flag "false" xref: spec_1_neutral_loss_964_composition "Hex(1) HexNAc(1) NeuAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_964_mono_mass "963.317944" xref: spec_1_neutral_loss_964_avge_mass "963.8417" xref: spec_1_neutral_loss_964_flag "false" xref: spec_1_neutral_loss_964_composition "Hex(1) HexNAc(1) NeuAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1618 name: dHex(1)Hex(1)HexNAc(2)Kdn(1) def: "DHex Hex HexNAc(2) Kdn ---OR--- Hex(2) HexNAc dHex NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1618] xref: record_id "1618" xref: delta_mono_mass "964.338345" xref: delta_avge_mass "964.8695" xref: delta_composition "dHex Hex HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 11:43:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_965_mono_mass "964.338345" xref: spec_1_neutral_loss_965_avge_mass "964.8695" xref: spec_1_neutral_loss_965_flag "false" xref: spec_1_neutral_loss_965_composition "dHex Hex HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_965_mono_mass "964.338345" xref: spec_1_neutral_loss_965_avge_mass "964.8695" xref: spec_1_neutral_loss_965_flag "false" xref: spec_1_neutral_loss_965_composition "dHex Hex HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1619 name: Hex(1)HexNAc(1)NeuGc(2) def: "Hex HexNAc NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1619] xref: record_id "1619" xref: delta_mono_mass "979.312859" xref: delta_avge_mass "979.8411" xref: delta_composition "Hex(1) HexNAc(1) NeuGc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_980_mono_mass "979.312859" xref: spec_1_neutral_loss_980_avge_mass "979.8411" xref: spec_1_neutral_loss_980_flag "false" xref: spec_1_neutral_loss_980_composition "Hex(1) HexNAc(1) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_980_mono_mass "979.312859" xref: spec_1_neutral_loss_980_avge_mass "979.8411" xref: spec_1_neutral_loss_980_flag "false" xref: spec_1_neutral_loss_980_composition "Hex(1) HexNAc(1) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1620 name: Hex(1)HexNAc(1)NeuAc(2)Ac(1) def: "Ac Hex HexNAc NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=1&hex=1&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1620] xref: record_id "1620" xref: delta_mono_mass "989.333594" xref: delta_avge_mass "989.879" xref: delta_composition "Ac Hex HexNAc NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:37:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_990_mono_mass "989.333594" xref: spec_1_neutral_loss_990_avge_mass "989.879" xref: spec_1_neutral_loss_990_flag "false" xref: spec_1_neutral_loss_990_composition "Ac Hex HexNAc NeuAc(2)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_990_mono_mass "989.333594" xref: spec_1_neutral_loss_990_avge_mass "989.879" xref: spec_1_neutral_loss_990_flag "false" xref: spec_1_neutral_loss_990_composition "Ac Hex HexNAc NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1621 name: dHex(2)Hex(2)HexA(1)HexNAc(1) def: "DHex(2) Hex(2) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1621] xref: record_id "1621" xref: delta_mono_mass "995.332925" xref: delta_avge_mass "995.8802" xref: delta_composition "dHex(2) Hex(2) HexA(1) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_996_mono_mass "995.332925" xref: spec_1_neutral_loss_996_avge_mass "995.8802" xref: spec_1_neutral_loss_996_flag "false" xref: spec_1_neutral_loss_996_composition "dHex(2) Hex(2) HexA(1) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_996_mono_mass "995.332925" xref: spec_1_neutral_loss_996_avge_mass "995.8802" xref: spec_1_neutral_loss_996_flag "false" xref: spec_1_neutral_loss_996_composition "dHex(2) Hex(2) HexA(1) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1622 name: dHex(1)Hex(1)HexNAc(3)Sulf(1) def: "DHex Hex HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1622] xref: record_id "1622" xref: delta_mono_mass "997.305665" xref: delta_avge_mass "997.9226" xref: delta_composition "O(3) S dHex Hex HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:29:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_998_mono_mass "997.305665" xref: spec_1_neutral_loss_998_avge_mass "997.9226" xref: spec_1_neutral_loss_998_flag "false" xref: spec_1_neutral_loss_998_composition "O(3) S dHex Hex HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_998_mono_mass "997.305665" xref: spec_1_neutral_loss_998_avge_mass "997.9226" xref: spec_1_neutral_loss_998_flag "false" xref: spec_1_neutral_loss_998_composition "O(3) S dHex Hex HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1623 name: Hex(2)HexA(1)NeuAc(1)Pent(1)Sulf(1) def: "Hex(2) HexA NeuAc Pent Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&pent=1&hex=2&hexa=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1623] xref: record_id "1623" xref: delta_mono_mass "1003.232225" xref: delta_avge_mass "1003.8377" xref: delta_composition "O(3) S Pent Hex(2) HexA NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:29:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1004_mono_mass "1003.232225" xref: spec_1_neutral_loss_1004_avge_mass "1003.8377" xref: spec_1_neutral_loss_1004_flag "false" xref: spec_1_neutral_loss_1004_composition "O(3) S Pent Hex(2) HexA NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1004_mono_mass "1003.232225" xref: spec_1_neutral_loss_1004_avge_mass "1003.8377" xref: spec_1_neutral_loss_1004_flag "false" xref: spec_1_neutral_loss_1004_composition "O(3) S Pent Hex(2) HexA NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1624 name: dHex(1)Hex(1)HexNAc(2)NeuAc(1) def: "DHex Hex HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1624] xref: record_id "1624" xref: delta_mono_mass "1005.364894" xref: delta_avge_mass "1005.9214" xref: delta_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1006_mono_mass "1005.364894" xref: spec_1_neutral_loss_1006_avge_mass "1005.9214" xref: spec_1_neutral_loss_1006_flag "false" xref: spec_1_neutral_loss_1006_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1006_mono_mass "1005.364894" xref: spec_1_neutral_loss_1006_avge_mass "1005.9214" xref: spec_1_neutral_loss_1006_flag "false" xref: spec_1_neutral_loss_1006_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1625 name: dHex(1)Hex(3)HexA(1)HexNAc(1) def: "DHex Hex(3) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1625] xref: record_id "1625" xref: delta_mono_mass "1011.32784" xref: delta_avge_mass "1011.8796" xref: delta_composition "dHex(1) Hex(3) HexA(1) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1012_mono_mass "1011.32784" xref: spec_1_neutral_loss_1012_avge_mass "1011.8796" xref: spec_1_neutral_loss_1012_flag "false" xref: spec_1_neutral_loss_1012_composition "dHex(1) Hex(3) HexA(1) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1012_mono_mass "1011.32784" xref: spec_1_neutral_loss_1012_avge_mass "1011.8796" xref: spec_1_neutral_loss_1012_flag "false" xref: spec_1_neutral_loss_1012_composition "dHex(1) Hex(3) HexA(1) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1626 name: Hex(2)HexNAc(3)Sulf(1) def: "Hex(2) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1626] xref: record_id "1626" xref: delta_mono_mass "1013.300579" xref: delta_avge_mass "1013.922" xref: delta_composition "O(3) S Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:30:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1014_mono_mass "1013.300579" xref: spec_1_neutral_loss_1014_avge_mass "1013.922" xref: spec_1_neutral_loss_1014_flag "false" xref: spec_1_neutral_loss_1014_composition "O(3) S Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1014_mono_mass "1013.300579" xref: spec_1_neutral_loss_1014_avge_mass "1013.922" xref: spec_1_neutral_loss_1014_flag "false" xref: spec_1_neutral_loss_1014_composition "O(3) S Hex(2) HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1627 name: Hex(5)HexNAc(1) def: "Hex(5) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1627] xref: record_id "1627" xref: delta_mono_mass "1013.34349" xref: delta_avge_mass "1013.8955" xref: delta_composition "Hex(5) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 11:00:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1014_mono_mass "1013.34349" xref: spec_1_neutral_loss_1014_avge_mass "1013.8955" xref: spec_1_neutral_loss_1014_flag "false" xref: spec_1_neutral_loss_1014_composition "Hex(5) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1014_mono_mass "1013.34349" xref: spec_1_neutral_loss_1014_avge_mass "1013.8955" xref: spec_1_neutral_loss_1014_flag "false" xref: spec_1_neutral_loss_1014_composition "Hex(5) HexNAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1014_mono_mass "1013.34349" xref: spec_2_neutral_loss_1014_avge_mass "1013.8955" xref: spec_2_neutral_loss_1014_flag "false" xref: spec_2_neutral_loss_1014_composition "Hex(5) HexNAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1628 name: HexNAc(5) def: "HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1628] xref: record_id "1628" xref: delta_mono_mass "1015.396863" xref: delta_avge_mass "1015.9626" xref: delta_composition "HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1016_mono_mass "1015.396863" xref: spec_1_neutral_loss_1016_avge_mass "1015.9626" xref: spec_1_neutral_loss_1016_flag "false" xref: spec_1_neutral_loss_1016_composition "HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1016_mono_mass "1015.396863" xref: spec_1_neutral_loss_1016_avge_mass "1015.9626" xref: spec_1_neutral_loss_1016_flag "false" xref: spec_1_neutral_loss_1016_composition "HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1630 name: Hex(1)HexNAc(1)NeuAc(2)Ac(2) def: "Ac(2) Hex HexNAc NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=2&hex=1&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1630] xref: record_id "1630" xref: delta_mono_mass "1031.344159" xref: delta_avge_mass "1031.9156" xref: delta_composition "Ac(2) Hex HexNAc NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:38:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1032_mono_mass "1031.344159" xref: spec_1_neutral_loss_1032_avge_mass "1031.9156" xref: spec_1_neutral_loss_1032_flag "false" xref: spec_1_neutral_loss_1032_composition "Ac(2) Hex HexNAc NeuAc(2)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1032_mono_mass "1031.344159" xref: spec_1_neutral_loss_1032_avge_mass "1031.9156" xref: spec_1_neutral_loss_1032_flag "false" xref: spec_1_neutral_loss_1032_composition "Ac(2) Hex HexNAc NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1631 name: Hex(2)HexNAc(2)NeuGc(1) def: "Hex(2) HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1631] xref: record_id "1631" xref: delta_mono_mass "1037.354723" xref: delta_avge_mass "1037.9202" xref: delta_composition "Hex(2) HexNAc(2) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1038_mono_mass "1037.354723" xref: spec_1_neutral_loss_1038_avge_mass "1037.9202" xref: spec_1_neutral_loss_1038_flag "false" xref: spec_1_neutral_loss_1038_composition "Hex(2) HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1038_mono_mass "1037.354723" xref: spec_1_neutral_loss_1038_avge_mass "1037.9202" xref: spec_1_neutral_loss_1038_flag "false" xref: spec_1_neutral_loss_1038_composition "Hex(2) HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1632 name: Hex(5)Phos(3) def: "Hex(5) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1632] xref: record_id "1632" xref: delta_mono_mass "1050.16311" xref: delta_avge_mass "1050.6427" xref: delta_composition "H(3) O(9) P(3) Hex(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:42:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1051_mono_mass "1050.16311" xref: spec_1_neutral_loss_1051_avge_mass "1050.6427" xref: spec_1_neutral_loss_1051_flag "false" xref: spec_1_neutral_loss_1051_composition "H(3) O(9) P(3) Hex(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1051_mono_mass "1050.16311" xref: spec_1_neutral_loss_1051_avge_mass "1050.6427" xref: spec_1_neutral_loss_1051_flag "false" xref: spec_1_neutral_loss_1051_composition "H(3) O(9) P(3) Hex(5)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1633 name: Hex(6)Phos(1) def: "Hex(6) Phos." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=1&hex=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1633] xref: record_id "1633" xref: delta_mono_mass "1052.283272" xref: delta_avge_mass "1052.8235" xref: delta_composition "H O(3) P Hex(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:42:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1053_mono_mass "1052.283272" xref: spec_1_neutral_loss_1053_avge_mass "1052.8235" xref: spec_1_neutral_loss_1053_flag "false" xref: spec_1_neutral_loss_1053_composition "H O(3) P Hex(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1053_mono_mass "1052.283272" xref: spec_1_neutral_loss_1053_avge_mass "1052.8235" xref: spec_1_neutral_loss_1053_flag "false" xref: spec_1_neutral_loss_1053_composition "H O(3) P Hex(6)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1634 name: dHex(1)Hex(2)HexA(1)HexNAc(2) def: "DHex Hex(2) HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1634] xref: record_id "1634" xref: delta_mono_mass "1052.354389" xref: delta_avge_mass "1052.9316" xref: delta_composition "dHex(1) Hex(2) HexA(1) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1053_mono_mass "1052.354389" xref: spec_1_neutral_loss_1053_avge_mass "1052.9316" xref: spec_1_neutral_loss_1053_flag "false" xref: spec_1_neutral_loss_1053_composition "dHex(1) Hex(2) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1053_mono_mass "1052.354389" xref: spec_1_neutral_loss_1053_avge_mass "1052.9316" xref: spec_1_neutral_loss_1053_flag "false" xref: spec_1_neutral_loss_1053_composition "dHex(1) Hex(2) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1635 name: dHex(2)Hex(3)HexNAc(1)Sulf(1) def: "DHex(2) Hex(3) HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1635] xref: record_id "1635" xref: delta_mono_mass "1061.310475" xref: delta_avge_mass "1061.9599" xref: delta_composition "O(3) S dHex(2) Hex(3) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:30:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1062_mono_mass "1061.310475" xref: spec_1_neutral_loss_1062_avge_mass "1061.9599" xref: spec_1_neutral_loss_1062_flag "false" xref: spec_1_neutral_loss_1062_composition "O(3) S dHex(2) Hex(3) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1062_mono_mass "1061.310475" xref: spec_1_neutral_loss_1062_avge_mass "1061.9599" xref: spec_1_neutral_loss_1062_flag "false" xref: spec_1_neutral_loss_1062_composition "O(3) S dHex(2) Hex(3) HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1636 name: Hex(1)HexNAc(3)NeuAc(1) def: "Hex HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1636] xref: record_id "1636" xref: delta_mono_mass "1062.386358" xref: delta_avge_mass "1062.9727" xref: delta_composition "Hex(1) HexNAc(3) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1063_mono_mass "1062.386358" xref: spec_1_neutral_loss_1063_avge_mass "1062.9727" xref: spec_1_neutral_loss_1063_flag "false" xref: spec_1_neutral_loss_1063_composition "Hex(1) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1063_mono_mass "1062.386358" xref: spec_1_neutral_loss_1063_avge_mass "1062.9727" xref: spec_1_neutral_loss_1063_flag "false" xref: spec_1_neutral_loss_1063_composition "Hex(1) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1637 name: dHex(2)Hex(1)HexNAc(3) def: "DHex(2) Hex HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1637] xref: record_id "1637" xref: delta_mono_mass "1063.406759" xref: delta_avge_mass "1064.0006" xref: delta_composition "dHex(2) Hex(1) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1064_mono_mass "1063.406759" xref: spec_1_neutral_loss_1064_avge_mass "1064.0006" xref: spec_1_neutral_loss_1064_flag "false" xref: spec_1_neutral_loss_1064_composition "dHex(2) Hex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1064_mono_mass "1063.406759" xref: spec_1_neutral_loss_1064_avge_mass "1064.0006" xref: spec_1_neutral_loss_1064_flag "false" xref: spec_1_neutral_loss_1064_composition "dHex(2) Hex(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1638 name: Hex(1)HexNAc(3)NeuGc(1) def: "Hex HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1638] xref: record_id "1638" xref: delta_mono_mass "1078.381273" xref: delta_avge_mass "1078.9721" xref: delta_composition "Hex(1) HexNAc(3) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1079_mono_mass "1078.381273" xref: spec_1_neutral_loss_1079_avge_mass "1078.9721" xref: spec_1_neutral_loss_1079_flag "false" xref: spec_1_neutral_loss_1079_composition "Hex(1) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1079_mono_mass "1078.381273" xref: spec_1_neutral_loss_1079_avge_mass "1078.9721" xref: spec_1_neutral_loss_1079_flag "false" xref: spec_1_neutral_loss_1079_composition "Hex(1) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1639 name: dHex(1)Hex(1)HexNAc(2)NeuAc(1)Sulf(1) def: "DHex Hex HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1639] xref: record_id "1639" xref: delta_mono_mass "1085.321709" xref: delta_avge_mass "1085.9846" xref: delta_composition "O(3) S dHex Hex HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:30:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1086_mono_mass "1085.321709" xref: spec_1_neutral_loss_1086_avge_mass "1085.9846" xref: spec_1_neutral_loss_1086_flag "false" xref: spec_1_neutral_loss_1086_composition "O(3) S dHex Hex HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1086_mono_mass "1085.321709" xref: spec_1_neutral_loss_1086_avge_mass "1085.9846" xref: spec_1_neutral_loss_1086_flag "false" xref: spec_1_neutral_loss_1086_composition "O(3) S dHex Hex HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1640 name: dHex(1)Hex(3)HexA(1)HexNAc(1)Sulf(1) def: "DHex Hex(3) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1640] xref: record_id "1640" xref: delta_mono_mass "1091.284655" xref: delta_avge_mass "1091.9428" xref: delta_composition "O(3) S dHex Hex(3) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:30:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1092_mono_mass "1091.284655" xref: spec_1_neutral_loss_1092_avge_mass "1091.9428" xref: spec_1_neutral_loss_1092_flag "false" xref: spec_1_neutral_loss_1092_composition "O(3) S dHex Hex(3) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1092_mono_mass "1091.284655" xref: spec_1_neutral_loss_1092_avge_mass "1091.9428" xref: spec_1_neutral_loss_1092_flag "false" xref: spec_1_neutral_loss_1092_composition "O(3) S dHex Hex(3) HexA HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1641 name: dHex(1)Hex(1)HexA(1)HexNAc(3) def: "DHex Hex HexA HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1641] xref: record_id "1641" xref: delta_mono_mass "1093.380938" xref: delta_avge_mass "1093.9835" xref: delta_composition "dHex(1) Hex(1) HexA(1) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1094_mono_mass "1093.380938" xref: spec_1_neutral_loss_1094_avge_mass "1093.9835" xref: spec_1_neutral_loss_1094_flag "false" xref: spec_1_neutral_loss_1094_composition "dHex(1) Hex(1) HexA(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1094_mono_mass "1093.380938" xref: spec_1_neutral_loss_1094_avge_mass "1093.9835" xref: spec_1_neutral_loss_1094_flag "false" xref: spec_1_neutral_loss_1094_composition "dHex(1) Hex(1) HexA(1) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1642 name: Hex(2)HexNAc(2)NeuAc(1)Sulf(1) def: "Hex(2) HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1642] xref: record_id "1642" xref: delta_mono_mass "1101.316623" xref: delta_avge_mass "1101.984" xref: delta_composition "O(3) S Hex(2) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:30:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1102_mono_mass "1101.316623" xref: spec_1_neutral_loss_1102_avge_mass "1101.984" xref: spec_1_neutral_loss_1102_flag "false" xref: spec_1_neutral_loss_1102_composition "O(3) S Hex(2) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1102_mono_mass "1101.316623" xref: spec_1_neutral_loss_1102_avge_mass "1101.984" xref: spec_1_neutral_loss_1102_flag "false" xref: spec_1_neutral_loss_1102_composition "O(3) S Hex(2) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1643 name: dHex(2)Hex(2)HexNAc(2)Sulf(1) def: "DHex(2) Hex(2) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1643] xref: record_id "1643" xref: delta_mono_mass "1102.337025" xref: delta_avge_mass "1103.0118" xref: delta_composition "O(3) S dHex(2) Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:31:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1103_mono_mass "1102.337025" xref: spec_1_neutral_loss_1103_avge_mass "1103.0118" xref: spec_1_neutral_loss_1103_flag "false" xref: spec_1_neutral_loss_1103_composition "O(3) S dHex(2) Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1103_mono_mass "1102.337025" xref: spec_1_neutral_loss_1103_avge_mass "1103.0118" xref: spec_1_neutral_loss_1103_flag "false" xref: spec_1_neutral_loss_1103_composition "O(3) S dHex(2) Hex(2) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1644 name: dHex(2)Hex(1)HexNAc(2)Kdn(1) def: "DHex(2) Hex HexNAc(2) Kdn ---OR--- Hex(2) HexNAc dHex(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1644] xref: record_id "1644" xref: delta_mono_mass "1110.396254" xref: delta_avge_mass "1111.0107" xref: delta_composition "dHex(2) Hex HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 12:14:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1111_mono_mass "1110.396254" xref: spec_1_neutral_loss_1111_avge_mass "1111.0107" xref: spec_1_neutral_loss_1111_flag "false" xref: spec_1_neutral_loss_1111_composition "dHex(2) Hex HexNAc(2) Kdn" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1111_mono_mass "1110.396254" xref: spec_1_neutral_loss_1111_avge_mass "1111.0107" xref: spec_1_neutral_loss_1111_flag "false" xref: spec_1_neutral_loss_1111_composition "dHex(2) Hex HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1645 name: dHex(1)Hex(1)HexNAc(4) def: "DHex Hex HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1645] xref: record_id "1645" xref: delta_mono_mass "1120.428223" xref: delta_avge_mass "1121.0519" xref: delta_composition "dHex(1) Hex(1) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1121_mono_mass "1120.428223" xref: spec_1_neutral_loss_1121_avge_mass "1121.0519" xref: spec_1_neutral_loss_1121_flag "false" xref: spec_1_neutral_loss_1121_composition "dHex(1) Hex(1) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1121_mono_mass "1120.428223" xref: spec_1_neutral_loss_1121_avge_mass "1121.0519" xref: spec_1_neutral_loss_1121_flag "false" xref: spec_1_neutral_loss_1121_composition "dHex(1) Hex(1) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1646 name: Hex(2)HexNAc(4) def: "Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1646] xref: record_id "1646" xref: delta_mono_mass "1136.423137" xref: delta_avge_mass "1137.0513" xref: delta_composition "Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 11:06:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1137_mono_mass "1136.423137" xref: spec_1_neutral_loss_1137_avge_mass "1137.0513" xref: spec_1_neutral_loss_1137_flag "false" xref: spec_1_neutral_loss_1137_composition "Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1137_mono_mass "1136.423137" xref: spec_1_neutral_loss_1137_avge_mass "1137.0513" xref: spec_1_neutral_loss_1137_flag "false" xref: spec_1_neutral_loss_1137_composition "Hex(2) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1137_mono_mass "1136.423137" xref: spec_2_neutral_loss_1137_avge_mass "1137.0513" xref: spec_2_neutral_loss_1137_flag "false" xref: spec_2_neutral_loss_1137_composition "Hex(2) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1647 name: Hex(2)HexNAc(1)NeuGc(2) def: "Hex(2) HexNAc NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1647] xref: record_id "1647" xref: delta_mono_mass "1141.365682" xref: delta_avge_mass "1141.9817" xref: delta_composition "Hex(2) HexNAc(1) NeuGc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1142_mono_mass "1141.365682" xref: spec_1_neutral_loss_1142_avge_mass "1141.9817" xref: spec_1_neutral_loss_1142_flag "false" xref: spec_1_neutral_loss_1142_composition "Hex(2) HexNAc(1) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1142_mono_mass "1141.365682" xref: spec_1_neutral_loss_1142_avge_mass "1141.9817" xref: spec_1_neutral_loss_1142_flag "false" xref: spec_1_neutral_loss_1142_composition "Hex(2) HexNAc(1) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1648 name: dHex(2)Hex(4)HexNAc(1) def: "DHex(2) Hex(4) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1648] xref: record_id "1648" xref: delta_mono_mass "1143.406484" xref: delta_avge_mass "1144.0373" xref: delta_composition "dHex(2) Hex(4) HexNAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1144_mono_mass "1143.406484" xref: spec_1_neutral_loss_1144_avge_mass "1144.0373" xref: spec_1_neutral_loss_1144_flag "false" xref: spec_1_neutral_loss_1144_composition "dHex(2) Hex(4) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1144_mono_mass "1143.406484" xref: spec_1_neutral_loss_1144_avge_mass "1144.0373" xref: spec_1_neutral_loss_1144_flag "false" xref: spec_1_neutral_loss_1144_composition "dHex(2) Hex(4) HexNAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1649 name: Hex(1)HexNAc(2)NeuAc(2) def: "Hex HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1649] xref: record_id "1649" xref: delta_mono_mass "1150.402402" xref: delta_avge_mass "1151.0348" xref: delta_composition "Hex(1) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1151_mono_mass "1150.402402" xref: spec_1_neutral_loss_1151_avge_mass "1151.0348" xref: spec_1_neutral_loss_1151_flag "false" xref: spec_1_neutral_loss_1151_composition "Hex(1) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1151_mono_mass "1150.402402" xref: spec_1_neutral_loss_1151_avge_mass "1151.0348" xref: spec_1_neutral_loss_1151_flag "false" xref: spec_1_neutral_loss_1151_composition "Hex(1) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1650 name: dHex(2)Hex(1)HexNAc(2)NeuAc(1) def: "DHex(2) Hex HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1650] xref: record_id "1650" xref: delta_mono_mass "1151.422803" xref: delta_avge_mass "1152.0626" xref: delta_composition "dHex(2) Hex(1) HexNAc(2) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1152_mono_mass "1151.422803" xref: spec_1_neutral_loss_1152_avge_mass "1152.0626" xref: spec_1_neutral_loss_1152_flag "false" xref: spec_1_neutral_loss_1152_composition "dHex(2) Hex(1) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1152_mono_mass "1151.422803" xref: spec_1_neutral_loss_1152_avge_mass "1152.0626" xref: spec_1_neutral_loss_1152_flag "false" xref: spec_1_neutral_loss_1152_composition "dHex(2) Hex(1) HexNAc(2) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1651 name: dHex(1)Hex(2)HexNAc(3)Sulf(1) def: "DHex Hex(2) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1651] xref: record_id "1651" xref: delta_mono_mass "1159.358488" xref: delta_avge_mass "1160.0632" xref: delta_composition "O(3) S dHex Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:31:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1160_mono_mass "1159.358488" xref: spec_1_neutral_loss_1160_avge_mass "1160.0632" xref: spec_1_neutral_loss_1160_flag "false" xref: spec_1_neutral_loss_1160_composition "O(3) S dHex Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1160_mono_mass "1159.358488" xref: spec_1_neutral_loss_1160_avge_mass "1160.0632" xref: spec_1_neutral_loss_1160_flag "false" xref: spec_1_neutral_loss_1160_composition "O(3) S dHex Hex(2) HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1652 name: dHex(1)HexNAc(5) def: "DHex HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1652] xref: record_id "1652" xref: delta_mono_mass "1161.454772" xref: delta_avge_mass "1162.1038" xref: delta_composition "dHex(1) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1162_mono_mass "1161.454772" xref: spec_1_neutral_loss_1162_avge_mass "1162.1038" xref: spec_1_neutral_loss_1162_flag "false" xref: spec_1_neutral_loss_1162_composition "dHex(1) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1162_mono_mass "1161.454772" xref: spec_1_neutral_loss_1162_avge_mass "1162.1038" xref: spec_1_neutral_loss_1162_flag "false" xref: spec_1_neutral_loss_1162_composition "dHex(1) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1653 name: dHex(2)Hex(1)HexNAc(2)NeuGc(1) def: "DHex(2) Hex HexNAc(2) NeuGc ---OR--- Hex(2) HexNAc(2) dHex NeuAc ---OR--- Hex HexNAc(3) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=1&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1653] xref: record_id "1653" xref: delta_mono_mass "1167.417718" xref: delta_avge_mass "1168.062" xref: delta_composition "dHex(2) Hex HexNAc(2) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 12:18:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1168_mono_mass "1167.417718" xref: spec_1_neutral_loss_1168_avge_mass "1168.062" xref: spec_1_neutral_loss_1168_flag "false" xref: spec_1_neutral_loss_1168_composition "dHex(2) Hex HexNAc(2) NeuGc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1168_mono_mass "1167.417718" xref: spec_1_neutral_loss_1168_avge_mass "1168.062" xref: spec_1_neutral_loss_1168_flag "false" xref: spec_1_neutral_loss_1168_composition "dHex(2) Hex HexNAc(2) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1654 name: dHex(3)Hex(2)HexNAc(2) def: "DHex(3) Hex(2) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1654] xref: record_id "1654" xref: delta_mono_mass "1168.438119" xref: delta_avge_mass "1169.0898" xref: delta_composition "dHex(3) Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1169_mono_mass "1168.438119" xref: spec_1_neutral_loss_1169_avge_mass "1169.0898" xref: spec_1_neutral_loss_1169_flag "false" xref: spec_1_neutral_loss_1169_composition "dHex(3) Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1169_mono_mass "1168.438119" xref: spec_1_neutral_loss_1169_avge_mass "1169.0898" xref: spec_1_neutral_loss_1169_flag "false" xref: spec_1_neutral_loss_1169_composition "dHex(3) Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1655 name: Hex(3)HexNAc(3)Sulf(1) def: "Hex(3) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1655] xref: record_id "1655" xref: delta_mono_mass "1175.353403" xref: delta_avge_mass "1176.0626" xref: delta_composition "O(3) S Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 11:08:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1176_mono_mass "1175.353403" xref: spec_1_neutral_loss_1176_avge_mass "1176.0626" xref: spec_1_neutral_loss_1176_flag "false" xref: spec_1_neutral_loss_1176_composition "O(3) S Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1176_mono_mass "1175.353403" xref: spec_1_neutral_loss_1176_avge_mass "1176.0626" xref: spec_1_neutral_loss_1176_flag "false" xref: spec_1_neutral_loss_1176_composition "O(3) S Hex(3) HexNAc(3)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1176_mono_mass "1175.353403" xref: spec_2_neutral_loss_1176_avge_mass "1176.0626" xref: spec_2_neutral_loss_1176_flag "false" xref: spec_2_neutral_loss_1176_composition "O(3) S Hex(3) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1656 name: dHex(2)Hex(2)HexNAc(2)Sulf(2) def: "DHex(2) Hex(2) HexNAc(2) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=2&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1656] xref: record_id "1656" xref: delta_mono_mass "1182.293839" xref: delta_avge_mass "1183.075" xref: delta_composition "O(6) S(2) dHex(2) Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:31:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1183_mono_mass "1182.293839" xref: spec_1_neutral_loss_1183_avge_mass "1183.075" xref: spec_1_neutral_loss_1183_flag "false" xref: spec_1_neutral_loss_1183_composition "O(6) S(2) dHex(2) Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1183_mono_mass "1182.293839" xref: spec_1_neutral_loss_1183_avge_mass "1183.075" xref: spec_1_neutral_loss_1183_flag "false" xref: spec_1_neutral_loss_1183_composition "O(6) S(2) dHex(2) Hex(2) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1657 name: dHex(1)Hex(2)HexNAc(2)NeuGc(1) def: "DHex Hex(2) HexNAc(2) NeuGc ---OR--- Hex(3) HexNAc(2) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1657] xref: record_id "1657" xref: delta_mono_mass "1183.412632" xref: delta_avge_mass "1184.0614" xref: delta_composition "dHex Hex(2) HexNAc(2) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 13:10:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1184_mono_mass "1183.412632" xref: spec_1_neutral_loss_1184_avge_mass "1184.0614" xref: spec_1_neutral_loss_1184_flag "false" xref: spec_1_neutral_loss_1184_composition "dHex Hex(2) HexNAc(2) NeuGc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1184_mono_mass "1183.412632" xref: spec_1_neutral_loss_1184_avge_mass "1184.0614" xref: spec_1_neutral_loss_1184_flag "false" xref: spec_1_neutral_loss_1184_composition "dHex Hex(2) HexNAc(2) NeuGc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1184_mono_mass "1183.412632" xref: spec_2_neutral_loss_1184_avge_mass "1184.0614" xref: spec_2_neutral_loss_1184_flag "false" xref: spec_2_neutral_loss_1184_composition "dHex Hex(2) HexNAc(2) NeuGc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1658 name: dHex(1)Hex(1)HexNAc(3)NeuAc(1) def: "DHex Hex HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1658] xref: record_id "1658" xref: delta_mono_mass "1208.444267" xref: delta_avge_mass "1209.1139" xref: delta_composition "dHex Hex HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-23 14:50:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1209_mono_mass "1208.444267" xref: spec_1_neutral_loss_1209_avge_mass "1209.1139" xref: spec_1_neutral_loss_1209_flag "false" xref: spec_1_neutral_loss_1209_composition "dHex Hex HexNAc(3) NeuAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1209_mono_mass "1208.444267" xref: spec_1_neutral_loss_1209_avge_mass "1209.1139" xref: spec_1_neutral_loss_1209_flag "false" xref: spec_1_neutral_loss_1209_composition "dHex Hex HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1659 name: Hex(6)Phos(3) def: "Hex(6) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1659] xref: record_id "1659" xref: delta_mono_mass "1212.215934" xref: delta_avge_mass "1212.7833" xref: delta_composition "H(3) O(9) P(3) Hex(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:42:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1213_mono_mass "1212.215934" xref: spec_1_neutral_loss_1213_avge_mass "1212.7833" xref: spec_1_neutral_loss_1213_flag "false" xref: spec_1_neutral_loss_1213_composition "H(3) O(9) P(3) Hex(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1213_mono_mass "1212.215934" xref: spec_1_neutral_loss_1213_avge_mass "1212.7833" xref: spec_1_neutral_loss_1213_flag "false" xref: spec_1_neutral_loss_1213_composition "H(3) O(9) P(3) Hex(6)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1660 name: dHex(1)Hex(3)HexA(1)HexNAc(2) def: "DHex Hex(3) HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1660] xref: record_id "1660" xref: delta_mono_mass "1214.407213" xref: delta_avge_mass "1215.0722" xref: delta_composition "dHex(1) Hex(3) HexA(1) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1215_mono_mass "1214.407213" xref: spec_1_neutral_loss_1215_avge_mass "1215.0722" xref: spec_1_neutral_loss_1215_flag "false" xref: spec_1_neutral_loss_1215_composition "dHex(1) Hex(3) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1215_mono_mass "1214.407213" xref: spec_1_neutral_loss_1215_avge_mass "1215.0722" xref: spec_1_neutral_loss_1215_flag "false" xref: spec_1_neutral_loss_1215_composition "dHex(1) Hex(3) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1661 name: dHex(1)Hex(1)HexNAc(3)NeuGc(1) def: "DHex Hex HexNAc(3) NeuGc ---OR--- Hex(2) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1661] xref: record_id "1661" xref: delta_mono_mass "1224.439181" xref: delta_avge_mass "1225.1133" xref: delta_composition "dHex Hex HexNAc(3) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 13:15:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1225_mono_mass "1224.439181" xref: spec_1_neutral_loss_1225_avge_mass "1225.1133" xref: spec_1_neutral_loss_1225_flag "false" xref: spec_1_neutral_loss_1225_composition "dHex Hex HexNAc(3) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1225_mono_mass "1224.439181" xref: spec_1_neutral_loss_1225_avge_mass "1225.1133" xref: spec_1_neutral_loss_1225_flag "false" xref: spec_1_neutral_loss_1225_composition "dHex Hex HexNAc(3) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1662 name: Hex(1)HexNAc(2)NeuAc(2)Sulf(1) def: "Hex HexNAc(2) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=1&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1662] xref: record_id "1662" xref: delta_mono_mass "1230.359217" xref: delta_avge_mass "1231.098" xref: delta_composition "O(3) S Hex HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:31:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1231_mono_mass "1230.359217" xref: spec_1_neutral_loss_1231_avge_mass "1231.098" xref: spec_1_neutral_loss_1231_flag "false" xref: spec_1_neutral_loss_1231_composition "O(3) S Hex HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1231_mono_mass "1230.359217" xref: spec_1_neutral_loss_1231_avge_mass "1231.098" xref: spec_1_neutral_loss_1231_flag "false" xref: spec_1_neutral_loss_1231_composition "O(3) S Hex HexNAc(2) NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1663 name: dHex(2)Hex(3)HexA(1)HexNAc(1)Sulf(1) def: "DHex(2) Hex(3) HexA HexNAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1663] xref: record_id "1663" xref: delta_mono_mass "1237.342563" xref: delta_avge_mass "1238.084" xref: delta_composition "O(3) S dHex(2) Hex(3) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:32:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1238_mono_mass "1237.342563" xref: spec_1_neutral_loss_1238_avge_mass "1238.084" xref: spec_1_neutral_loss_1238_flag "false" xref: spec_1_neutral_loss_1238_composition "O(3) S dHex(2) Hex(3) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1238_mono_mass "1237.342563" xref: spec_1_neutral_loss_1238_avge_mass "1238.084" xref: spec_1_neutral_loss_1238_flag "false" xref: spec_1_neutral_loss_1238_composition "O(3) S dHex(2) Hex(3) HexA HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1664 name: Hex(1)HexNAc(1)NeuAc(3) def: "Hex HexNAc NeuAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1664] xref: record_id "1664" xref: delta_mono_mass "1238.418446" xref: delta_avge_mass "1239.0969" xref: delta_composition "Hex(1) HexNAc(1) NeuAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1239_mono_mass "1238.418446" xref: spec_1_neutral_loss_1239_avge_mass "1239.0969" xref: spec_1_neutral_loss_1239_flag "false" xref: spec_1_neutral_loss_1239_composition "Hex(1) HexNAc(1) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1239_mono_mass "1238.418446" xref: spec_1_neutral_loss_1239_avge_mass "1239.0969" xref: spec_1_neutral_loss_1239_flag "false" xref: spec_1_neutral_loss_1239_composition "Hex(1) HexNAc(1) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1665 name: Hex(2)HexNAc(3)NeuGc(1) def: "Hex(2) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1665] xref: record_id "1665" xref: delta_mono_mass "1240.434096" xref: delta_avge_mass "1241.1127" xref: delta_composition "Hex(2) HexNAc(3) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1241_mono_mass "1240.434096" xref: spec_1_neutral_loss_1241_avge_mass "1241.1127" xref: spec_1_neutral_loss_1241_flag "false" xref: spec_1_neutral_loss_1241_composition "Hex(2) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1241_mono_mass "1240.434096" xref: spec_1_neutral_loss_1241_avge_mass "1241.1127" xref: spec_1_neutral_loss_1241_flag "false" xref: spec_1_neutral_loss_1241_composition "Hex(2) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1666 name: dHex(1)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) def: "DHex Hex(2) HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1666] xref: record_id "1666" xref: delta_mono_mass "1247.374532" xref: delta_avge_mass "1248.1252" xref: delta_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:32:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1248_mono_mass "1247.374532" xref: spec_1_neutral_loss_1248_avge_mass "1248.1252" xref: spec_1_neutral_loss_1248_flag "false" xref: spec_1_neutral_loss_1248_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1248_mono_mass "1247.374532" xref: spec_1_neutral_loss_1248_avge_mass "1248.1252" xref: spec_1_neutral_loss_1248_flag "false" xref: spec_1_neutral_loss_1248_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1667 name: dHex(3)Hex(1)HexNAc(2)Kdn(1) def: "DHex(3) Hex HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1667] xref: record_id "1667" xref: delta_mono_mass "1256.454163" xref: delta_avge_mass "1257.1519" xref: delta_composition "dHex(3) Hex HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:57:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1257_mono_mass "1256.454163" xref: spec_1_neutral_loss_1257_avge_mass "1257.1519" xref: spec_1_neutral_loss_1257_flag "false" xref: spec_1_neutral_loss_1257_composition "dHex(3) Hex HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1257_mono_mass "1256.454163" xref: spec_1_neutral_loss_1257_avge_mass "1257.1519" xref: spec_1_neutral_loss_1257_flag "false" xref: spec_1_neutral_loss_1257_composition "dHex(3) Hex HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1668 name: dHex(2)Hex(3)HexNAc(2)Sulf(1) def: "DHex(2) Hex(3) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1668] xref: record_id "1668" xref: delta_mono_mass "1264.389848" xref: delta_avge_mass "1265.1524" xref: delta_composition "O(3) S dHex(2) Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:32:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1265_mono_mass "1264.389848" xref: spec_1_neutral_loss_1265_avge_mass "1265.1524" xref: spec_1_neutral_loss_1265_flag "false" xref: spec_1_neutral_loss_1265_composition "O(3) S dHex(2) Hex(3) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1265_mono_mass "1264.389848" xref: spec_1_neutral_loss_1265_avge_mass "1265.1524" xref: spec_1_neutral_loss_1265_flag "false" xref: spec_1_neutral_loss_1265_composition "O(3) S dHex(2) Hex(3) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1669 name: dHex(2)Hex(2)HexNAc(2)Kdn(1) def: "DHex(2) Hex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1669] xref: record_id "1669" xref: delta_mono_mass "1272.449077" xref: delta_avge_mass "1273.1513" xref: delta_composition "dHex(2) Hex(2) HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1273_mono_mass "1272.449077" xref: spec_1_neutral_loss_1273_avge_mass "1273.1513" xref: spec_1_neutral_loss_1273_flag "false" xref: spec_1_neutral_loss_1273_composition "dHex(2) Hex(2) HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1273_mono_mass "1272.449077" xref: spec_1_neutral_loss_1273_avge_mass "1273.1513" xref: spec_1_neutral_loss_1273_flag "false" xref: spec_1_neutral_loss_1273_composition "dHex(2) Hex(2) HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1670 name: dHex(2)Hex(2)HexA(1)HexNAc(2)Sulf(1) def: "DHex(2) Hex(2) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1670] xref: record_id "1670" xref: delta_mono_mass "1278.369113" xref: delta_avge_mass "1279.136" xref: delta_composition "O(3) S dHex(2) Hex(2) HexA HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:32:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1279_mono_mass "1278.369113" xref: spec_1_neutral_loss_1279_avge_mass "1279.136" xref: spec_1_neutral_loss_1279_flag "false" xref: spec_1_neutral_loss_1279_composition "O(3) S dHex(2) Hex(2) HexA HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1279_mono_mass "1278.369113" xref: spec_1_neutral_loss_1279_avge_mass "1279.136" xref: spec_1_neutral_loss_1279_flag "false" xref: spec_1_neutral_loss_1279_composition "O(3) S dHex(2) Hex(2) HexA HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1671 name: dHex(1)Hex(2)HexNAc(4) def: "DHex Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1671] xref: record_id "1671" xref: delta_mono_mass "1282.481046" xref: delta_avge_mass "1283.1925" xref: delta_composition "dHex Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 12:00:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1283_mono_mass "1282.481046" xref: spec_1_neutral_loss_1283_avge_mass "1283.1925" xref: spec_1_neutral_loss_1283_flag "false" xref: spec_1_neutral_loss_1283_composition "dHex Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1283_mono_mass "1282.481046" xref: spec_1_neutral_loss_1283_avge_mass "1283.1925" xref: spec_1_neutral_loss_1283_flag "false" xref: spec_1_neutral_loss_1283_composition "dHex Hex(2) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1283_mono_mass "1282.481046" xref: spec_2_neutral_loss_1283_avge_mass "1283.1925" xref: spec_2_neutral_loss_1283_flag "false" xref: spec_2_neutral_loss_1283_composition "dHex Hex(2) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1672 name: Hex(1)HexNAc(1)NeuGc(3) def: "Hex HexNAc NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1672] xref: record_id "1672" xref: delta_mono_mass "1286.40319" xref: delta_avge_mass "1287.0951" xref: delta_composition "Hex(1) HexNAc(1) NeuGc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1287_mono_mass "1286.40319" xref: spec_1_neutral_loss_1287_avge_mass "1287.0951" xref: spec_1_neutral_loss_1287_flag "false" xref: spec_1_neutral_loss_1287_composition "Hex(1) HexNAc(1) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1287_mono_mass "1286.40319" xref: spec_1_neutral_loss_1287_avge_mass "1287.0951" xref: spec_1_neutral_loss_1287_flag "false" xref: spec_1_neutral_loss_1287_composition "Hex(1) HexNAc(1) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1673 name: dHex(1)Hex(1)HexNAc(3)NeuAc(1)Sulf(1) def: "DHex Hex HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1673] xref: record_id "1673" xref: delta_mono_mass "1288.401081" xref: delta_avge_mass "1289.1771" xref: delta_composition "O(3) S dHex Hex HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:32:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1289_mono_mass "1288.401081" xref: spec_1_neutral_loss_1289_avge_mass "1289.1771" xref: spec_1_neutral_loss_1289_flag "false" xref: spec_1_neutral_loss_1289_composition "O(3) S dHex Hex HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1289_mono_mass "1288.401081" xref: spec_1_neutral_loss_1289_avge_mass "1289.1771" xref: spec_1_neutral_loss_1289_flag "false" xref: spec_1_neutral_loss_1289_composition "O(3) S dHex Hex HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1674 name: dHex(1)Hex(3)HexA(1)HexNAc(2)Sulf(1) def: "DHex Hex(3) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1674] xref: record_id "1674" xref: delta_mono_mass "1294.364027" xref: delta_avge_mass "1295.1354" xref: delta_composition "O(3) S dHex Hex(3) HexA HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:33:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1295_mono_mass "1294.364027" xref: spec_1_neutral_loss_1295_avge_mass "1295.1354" xref: spec_1_neutral_loss_1295_flag "false" xref: spec_1_neutral_loss_1295_composition "O(3) S dHex Hex(3) HexA HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1295_mono_mass "1294.364027" xref: spec_1_neutral_loss_1295_avge_mass "1295.1354" xref: spec_1_neutral_loss_1295_flag "false" xref: spec_1_neutral_loss_1295_composition "O(3) S dHex Hex(3) HexA HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1675 name: dHex(1)Hex(1)HexNAc(2)NeuAc(2) def: "DHex Hex HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=1&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1675] xref: record_id "1675" xref: delta_mono_mass "1296.460311" xref: delta_avge_mass "1297.176" xref: delta_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1297_mono_mass "1296.460311" xref: spec_1_neutral_loss_1297_avge_mass "1297.176" xref: spec_1_neutral_loss_1297_flag "false" xref: spec_1_neutral_loss_1297_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1297_mono_mass "1296.460311" xref: spec_1_neutral_loss_1297_avge_mass "1297.176" xref: spec_1_neutral_loss_1297_flag "false" xref: spec_1_neutral_loss_1297_composition "dHex(1) Hex(1) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1676 name: dHex(3)HexNAc(3)Kdn(1) def: "DHex(3) HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1676] xref: record_id "1676" xref: delta_mono_mass "1297.480712" xref: delta_avge_mass "1298.2038" xref: delta_composition "dHex(3) HexNAc(3) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:57:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1298_mono_mass "1297.480712" xref: spec_1_neutral_loss_1298_avge_mass "1298.2038" xref: spec_1_neutral_loss_1298_flag "false" xref: spec_1_neutral_loss_1298_composition "dHex(3) HexNAc(3) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1298_mono_mass "1297.480712" xref: spec_1_neutral_loss_1298_avge_mass "1298.2038" xref: spec_1_neutral_loss_1298_flag "false" xref: spec_1_neutral_loss_1298_composition "dHex(3) HexNAc(3) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1678 name: Hex(2)HexNAc(3)NeuAc(1)Sulf(1) def: "Hex(2) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1678] xref: record_id "1678" xref: delta_mono_mass "1304.395996" xref: delta_avge_mass "1305.1765" xref: delta_composition "O(3) S Hex(2) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:33:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1305_mono_mass "1304.395996" xref: spec_1_neutral_loss_1305_avge_mass "1305.1765" xref: spec_1_neutral_loss_1305_flag "false" xref: spec_1_neutral_loss_1305_composition "O(3) S Hex(2) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1305_mono_mass "1304.395996" xref: spec_1_neutral_loss_1305_avge_mass "1305.1765" xref: spec_1_neutral_loss_1305_flag "false" xref: spec_1_neutral_loss_1305_composition "O(3) S Hex(2) HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1679 name: dHex(2)Hex(2)HexNAc(3)Sulf(1) def: "DHex(2) Hex(2) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1679] xref: record_id "1679" xref: delta_mono_mass "1305.416397" xref: delta_avge_mass "1306.2044" xref: delta_composition "O(3) S dHex(2) Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:33:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1306_mono_mass "1305.416397" xref: spec_1_neutral_loss_1306_avge_mass "1306.2044" xref: spec_1_neutral_loss_1306_flag "false" xref: spec_1_neutral_loss_1306_composition "O(3) S dHex(2) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1306_mono_mass "1305.416397" xref: spec_1_neutral_loss_1306_avge_mass "1306.2044" xref: spec_1_neutral_loss_1306_flag "false" xref: spec_1_neutral_loss_1306_composition "O(3) S dHex(2) Hex(2) HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1680 name: dHex(2)HexNAc(5) def: "DHex(2) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1680] xref: record_id "1680" xref: delta_mono_mass "1307.512681" xref: delta_avge_mass "1308.245" xref: delta_composition "dHex(2) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1308_mono_mass "1307.512681" xref: spec_1_neutral_loss_1308_avge_mass "1308.245" xref: spec_1_neutral_loss_1308_flag "false" xref: spec_1_neutral_loss_1308_composition "dHex(2) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1308_mono_mass "1307.512681" xref: spec_1_neutral_loss_1308_avge_mass "1308.245" xref: spec_1_neutral_loss_1308_flag "false" xref: spec_1_neutral_loss_1308_composition "dHex(2) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1681 name: Hex(2)HexNAc(2)NeuAc(2) def: "Hex(2) HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1681] xref: record_id "1681" xref: delta_mono_mass "1312.455225" xref: delta_avge_mass "1313.1754" xref: delta_composition "Hex(2) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1313_mono_mass "1312.455225" xref: spec_1_neutral_loss_1313_avge_mass "1313.1754" xref: spec_1_neutral_loss_1313_flag "false" xref: spec_1_neutral_loss_1313_composition "Hex(2) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1313_mono_mass "1312.455225" xref: spec_1_neutral_loss_1313_avge_mass "1313.1754" xref: spec_1_neutral_loss_1313_flag "false" xref: spec_1_neutral_loss_1313_composition "Hex(2) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1682 name: dHex(2)Hex(2)HexNAc(2)NeuAc(1) def: "DHex(2) Hex(2) HexNAc(2) NeuAc ---OR--- Hex HexNAc(3) dHex(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1682] xref: record_id "1682" xref: delta_mono_mass "1313.475627" xref: delta_avge_mass "1314.2032" xref: delta_composition "dHex(2) Hex(2) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 13:21:07" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1314_mono_mass "1313.475627" xref: spec_1_neutral_loss_1314_avge_mass "1314.2032" xref: spec_1_neutral_loss_1314_flag "false" xref: spec_1_neutral_loss_1314_composition "dHex(2) Hex(2) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1314_mono_mass "1313.475627" xref: spec_1_neutral_loss_1314_avge_mass "1314.2032" xref: spec_1_neutral_loss_1314_flag "false" xref: spec_1_neutral_loss_1314_composition "dHex(2) Hex(2) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1683 name: dHex(1)Hex(3)HexNAc(3)Sulf(1) def: "DHex Hex(3) HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1683] xref: record_id "1683" xref: delta_mono_mass "1321.411312" xref: delta_avge_mass "1322.2038" xref: delta_composition "O(3) S dHex Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:33:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1322_mono_mass "1321.411312" xref: spec_1_neutral_loss_1322_avge_mass "1322.2038" xref: spec_1_neutral_loss_1322_flag "false" xref: spec_1_neutral_loss_1322_composition "O(3) S dHex Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1322_mono_mass "1321.411312" xref: spec_1_neutral_loss_1322_avge_mass "1322.2038" xref: spec_1_neutral_loss_1322_flag "false" xref: spec_1_neutral_loss_1322_composition "O(3) S dHex Hex(3) HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1684 name: dHex(2)Hex(2)HexNAc(2)NeuGc(1) def: "DHex(2) Hex(2) HexNAc(2) NeuGc ---OR--- Hex(3) HexNAc(2) dHex NeuAc ---OR--- Hex(2) HexNAc(3) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1684] xref: record_id "1684" xref: delta_mono_mass "1329.470541" xref: delta_avge_mass "1330.2026" xref: delta_composition "dHex(2) Hex(2) HexNAc(2) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 13:27:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1330_mono_mass "1329.470541" xref: spec_1_neutral_loss_1330_avge_mass "1330.2026" xref: spec_1_neutral_loss_1330_flag "false" xref: spec_1_neutral_loss_1330_composition "dHex(2) Hex(2) HexNAc(2) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1330_mono_mass "1329.470541" xref: spec_1_neutral_loss_1330_avge_mass "1330.2026" xref: spec_1_neutral_loss_1330_flag "false" xref: spec_1_neutral_loss_1330_composition "dHex(2) Hex(2) HexNAc(2) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1685 name: Hex(2)HexNAc(5) def: "Hex(2) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1685] xref: record_id "1685" xref: delta_mono_mass "1339.50251" xref: delta_avge_mass "1340.2438" xref: delta_composition "Hex(2) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1340_mono_mass "1339.50251" xref: spec_1_neutral_loss_1340_avge_mass "1340.2438" xref: spec_1_neutral_loss_1340_flag "false" xref: spec_1_neutral_loss_1340_composition "Hex(2) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1340_mono_mass "1339.50251" xref: spec_1_neutral_loss_1340_avge_mass "1340.2438" xref: spec_1_neutral_loss_1340_flag "false" xref: spec_1_neutral_loss_1340_composition "Hex(2) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1686 name: dHex(1)Hex(3)HexNAc(2)NeuGc(1) def: "DHex Hex(3) HexNAc(2) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1686] xref: record_id "1686" xref: delta_mono_mass "1345.465456" xref: delta_avge_mass "1346.202" xref: delta_composition "dHex(1) Hex(3) HexNAc(2) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1346_mono_mass "1345.465456" xref: spec_1_neutral_loss_1346_avge_mass "1346.202" xref: spec_1_neutral_loss_1346_flag "false" xref: spec_1_neutral_loss_1346_composition "dHex(1) Hex(3) HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1346_mono_mass "1345.465456" xref: spec_1_neutral_loss_1346_avge_mass "1346.202" xref: spec_1_neutral_loss_1346_flag "false" xref: spec_1_neutral_loss_1346_composition "dHex(1) Hex(3) HexNAc(2) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1687 name: Hex(1)HexNAc(3)NeuAc(2) def: "Hex HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1687] xref: record_id "1687" xref: delta_mono_mass "1353.481775" xref: delta_avge_mass "1354.2273" xref: delta_composition "Hex(1) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1354_mono_mass "1353.481775" xref: spec_1_neutral_loss_1354_avge_mass "1354.2273" xref: spec_1_neutral_loss_1354_flag "false" xref: spec_1_neutral_loss_1354_composition "Hex(1) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1354_mono_mass "1353.481775" xref: spec_1_neutral_loss_1354_avge_mass "1354.2273" xref: spec_1_neutral_loss_1354_flag "false" xref: spec_1_neutral_loss_1354_composition "Hex(1) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1688 name: dHex(1)Hex(2)HexNAc(3)NeuAc(1) def: "DHex Hex(2) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1688] xref: record_id "1688" xref: delta_mono_mass "1370.49709" xref: delta_avge_mass "1371.2545" xref: delta_composition "dHex(1) Hex(2) HexNAc(3) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1371_mono_mass "1370.49709" xref: spec_1_neutral_loss_1371_avge_mass "1371.2545" xref: spec_1_neutral_loss_1371_flag "false" xref: spec_1_neutral_loss_1371_composition "dHex(1) Hex(2) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1371_mono_mass "1370.49709" xref: spec_1_neutral_loss_1371_avge_mass "1371.2545" xref: spec_1_neutral_loss_1371_flag "false" xref: spec_1_neutral_loss_1371_composition "dHex(1) Hex(2) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1689 name: dHex(3)Hex(2)HexNAc(3) def: "DHex(3) Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1689] xref: record_id "1689" xref: delta_mono_mass "1371.517491" xref: delta_avge_mass "1372.2824" xref: delta_composition "dHex(3) Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1372_mono_mass "1371.517491" xref: spec_1_neutral_loss_1372_avge_mass "1372.2824" xref: spec_1_neutral_loss_1372_flag "false" xref: spec_1_neutral_loss_1372_composition "dHex(3) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1372_mono_mass "1371.517491" xref: spec_1_neutral_loss_1372_avge_mass "1372.2824" xref: spec_1_neutral_loss_1372_flag "false" xref: spec_1_neutral_loss_1372_composition "dHex(3) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1690 name: Hex(7)Phos(3) def: "Hex(7) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1690] xref: record_id "1690" xref: delta_mono_mass "1374.268757" xref: delta_avge_mass "1374.9239" xref: delta_composition "H(3) O(9) P(3) Hex(7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:43:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1375_mono_mass "1374.268757" xref: spec_1_neutral_loss_1375_avge_mass "1374.9239" xref: spec_1_neutral_loss_1375_flag "false" xref: spec_1_neutral_loss_1375_composition "H(3) O(9) P(3) Hex(7)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1375_mono_mass "1374.268757" xref: spec_1_neutral_loss_1375_avge_mass "1374.9239" xref: spec_1_neutral_loss_1375_flag "false" xref: spec_1_neutral_loss_1375_composition "H(3) O(9) P(3) Hex(7)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1691 name: dHex(1)Hex(4)HexA(1)HexNAc(2) def: "DHex Hex(4) HexA HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1691] xref: record_id "1691" xref: delta_mono_mass "1376.460036" xref: delta_avge_mass "1377.2128" xref: delta_composition "dHex(1) Hex(4) HexA(1) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1377_mono_mass "1376.460036" xref: spec_1_neutral_loss_1377_avge_mass "1377.2128" xref: spec_1_neutral_loss_1377_flag "false" xref: spec_1_neutral_loss_1377_composition "dHex(1) Hex(4) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1377_mono_mass "1376.460036" xref: spec_1_neutral_loss_1377_avge_mass "1377.2128" xref: spec_1_neutral_loss_1377_flag "false" xref: spec_1_neutral_loss_1377_composition "dHex(1) Hex(4) HexA(1) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1692 name: Hex(3)HexNAc(3)NeuAc(1) def: "Hex(3) HexNAc(3) NeuAc ---OR--- Hex(2) HexNAc(3) dHex NeuGc ---OR--- Hex(2) HexNAc(4) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1692] xref: record_id "1692" xref: delta_mono_mass "1386.492005" xref: delta_avge_mass "1387.2539" xref: delta_composition "Hex(3) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 15:15:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1387_mono_mass "1386.492005" xref: spec_1_neutral_loss_1387_avge_mass "1387.2539" xref: spec_1_neutral_loss_1387_flag "false" xref: spec_1_neutral_loss_1387_composition "Hex(3) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1387_mono_mass "1386.492005" xref: spec_1_neutral_loss_1387_avge_mass "1387.2539" xref: spec_1_neutral_loss_1387_flag "false" xref: spec_1_neutral_loss_1387_composition "Hex(3) HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1693 name: dHex(1)Hex(3)HexA(2)HexNAc(2) def: "DHex Hex(3) HexA(2) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexa=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1693] xref: record_id "1693" xref: delta_mono_mass "1390.439301" xref: delta_avge_mass "1391.1963" xref: delta_composition "dHex(1) Hex(3) HexA(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1391_mono_mass "1390.439301" xref: spec_1_neutral_loss_1391_avge_mass "1391.1963" xref: spec_1_neutral_loss_1391_flag "false" xref: spec_1_neutral_loss_1391_composition "dHex(1) Hex(3) HexA(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1391_mono_mass "1390.439301" xref: spec_1_neutral_loss_1391_avge_mass "1391.1963" xref: spec_1_neutral_loss_1391_flag "false" xref: spec_1_neutral_loss_1391_composition "dHex(1) Hex(3) HexA(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1694 name: Hex(2)HexNAc(2)NeuAc(2)Sulf(1) def: "Hex(2) HexNAc(2) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1694] xref: record_id "1694" xref: delta_mono_mass "1392.41204" xref: delta_avge_mass "1393.2386" xref: delta_composition "O(3) S Hex(2) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:34:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1393_mono_mass "1392.41204" xref: spec_1_neutral_loss_1393_avge_mass "1393.2386" xref: spec_1_neutral_loss_1393_flag "false" xref: spec_1_neutral_loss_1393_composition "O(3) S Hex(2) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1393_mono_mass "1392.41204" xref: spec_1_neutral_loss_1393_avge_mass "1393.2386" xref: spec_1_neutral_loss_1393_flag "false" xref: spec_1_neutral_loss_1393_composition "O(3) S Hex(2) HexNAc(2) NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1695 name: dHex(2)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) def: "DHex(2) Hex(2) HexNAc(2) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1695] xref: record_id "1695" xref: delta_mono_mass "1393.432441" xref: delta_avge_mass "1394.2664" xref: delta_composition "O(3) S dHex(2) Hex(2) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:34:15" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1394_mono_mass "1393.432441" xref: spec_1_neutral_loss_1394_avge_mass "1394.2664" xref: spec_1_neutral_loss_1394_flag "false" xref: spec_1_neutral_loss_1394_composition "O(3) S dHex(2) Hex(2) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1394_mono_mass "1393.432441" xref: spec_1_neutral_loss_1394_avge_mass "1394.2664" xref: spec_1_neutral_loss_1394_flag "false" xref: spec_1_neutral_loss_1394_composition "O(3) S dHex(2) Hex(2) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1696 name: Hex(3)HexNAc(3)NeuGc(1) def: "Hex(3) HexNAc(3) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1696] xref: record_id "1696" xref: delta_mono_mass "1402.48692" xref: delta_avge_mass "1403.2533" xref: delta_composition "Hex(3) HexNAc(3) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1403_mono_mass "1402.48692" xref: spec_1_neutral_loss_1403_avge_mass "1403.2533" xref: spec_1_neutral_loss_1403_flag "false" xref: spec_1_neutral_loss_1403_composition "Hex(3) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1403_mono_mass "1402.48692" xref: spec_1_neutral_loss_1403_avge_mass "1403.2533" xref: spec_1_neutral_loss_1403_flag "false" xref: spec_1_neutral_loss_1403_composition "Hex(3) HexNAc(3) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1697 name: dHex(4)Hex(1)HexNAc(2)Kdn(1) def: "DHex(4) Hex HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=1&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1697] xref: record_id "1697" xref: delta_mono_mass "1402.512072" xref: delta_avge_mass "1403.2931" xref: delta_composition "dHex(4) Hex HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1403_mono_mass "1402.512072" xref: spec_1_neutral_loss_1403_avge_mass "1403.2931" xref: spec_1_neutral_loss_1403_flag "false" xref: spec_1_neutral_loss_1403_composition "dHex(4) Hex HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1403_mono_mass "1402.512072" xref: spec_1_neutral_loss_1403_avge_mass "1403.2931" xref: spec_1_neutral_loss_1403_flag "false" xref: spec_1_neutral_loss_1403_composition "dHex(4) Hex HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1698 name: dHex(3)Hex(2)HexNAc(2)Kdn(1) def: "DHex(3) Hex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1698] xref: record_id "1698" xref: delta_mono_mass "1418.506986" xref: delta_avge_mass "1419.2925" xref: delta_composition "dHex(3) Hex(2) HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1419_mono_mass "1418.506986" xref: spec_1_neutral_loss_1419_avge_mass "1419.2925" xref: spec_1_neutral_loss_1419_flag "false" xref: spec_1_neutral_loss_1419_composition "dHex(3) Hex(2) HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1419_mono_mass "1418.506986" xref: spec_1_neutral_loss_1419_avge_mass "1419.2925" xref: spec_1_neutral_loss_1419_flag "false" xref: spec_1_neutral_loss_1419_composition "dHex(3) Hex(2) HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1699 name: dHex(3)Hex(2)HexA(1)HexNAc(2)Sulf(1) def: "DHex(3) Hex(2) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=3&hex=2&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1699] xref: record_id "1699" xref: delta_mono_mass "1424.427021" xref: delta_avge_mass "1425.2772" xref: delta_composition "O(3) S dHex(3) Hex(2) HexA HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:55:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1425_mono_mass "1424.427021" xref: spec_1_neutral_loss_1425_avge_mass "1425.2772" xref: spec_1_neutral_loss_1425_flag "false" xref: spec_1_neutral_loss_1425_composition "O(3) S dHex(3) Hex(2) HexA HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1425_mono_mass "1424.427021" xref: spec_1_neutral_loss_1425_avge_mass "1425.2772" xref: spec_1_neutral_loss_1425_flag "false" xref: spec_1_neutral_loss_1425_composition "O(3) S dHex(3) Hex(2) HexA HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1700 name: Hex(2)HexNAc(4)NeuAc(1) def: "Hex(2) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1700] xref: record_id "1700" xref: delta_mono_mass "1427.518554" xref: delta_avge_mass "1428.3059" xref: delta_composition "Hex(2) HexNAc(4) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1428_mono_mass "1427.518554" xref: spec_1_neutral_loss_1428_avge_mass "1428.3059" xref: spec_1_neutral_loss_1428_flag "false" xref: spec_1_neutral_loss_1428_composition "Hex(2) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1428_mono_mass "1427.518554" xref: spec_1_neutral_loss_1428_avge_mass "1428.3059" xref: spec_1_neutral_loss_1428_flag "false" xref: spec_1_neutral_loss_1428_composition "Hex(2) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1701 name: dHex(2)Hex(2)HexNAc(4) def: "DHex(2) Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1701] xref: record_id "1701" xref: delta_mono_mass "1428.538955" xref: delta_avge_mass "1429.3337" xref: delta_composition "dHex(2) Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1429_mono_mass "1428.538955" xref: spec_1_neutral_loss_1429_avge_mass "1429.3337" xref: spec_1_neutral_loss_1429_flag "false" xref: spec_1_neutral_loss_1429_composition "dHex(2) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1429_mono_mass "1428.538955" xref: spec_1_neutral_loss_1429_avge_mass "1429.3337" xref: spec_1_neutral_loss_1429_flag "false" xref: spec_1_neutral_loss_1429_composition "dHex(2) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1702 name: dHex(2)Hex(3)HexA(1)HexNAc(2)Sulf(1) def: "DHex(2) Hex(3) HexA HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexa=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1702] xref: record_id "1702" xref: delta_mono_mass "1440.421936" xref: delta_avge_mass "1441.2766" xref: delta_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:55:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1441_mono_mass "1440.421936" xref: spec_1_neutral_loss_1441_avge_mass "1441.2766" xref: spec_1_neutral_loss_1441_flag "false" xref: spec_1_neutral_loss_1441_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1441_mono_mass "1440.421936" xref: spec_1_neutral_loss_1441_avge_mass "1441.2766" xref: spec_1_neutral_loss_1441_flag "false" xref: spec_1_neutral_loss_1441_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1703 name: dHex(4)HexNAc(3)Kdn(1) def: "DHex(4) HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1703] xref: record_id "1703" xref: delta_mono_mass "1443.538621" xref: delta_avge_mass "1444.345" xref: delta_composition "dHex(4) HexNAc(3) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1444_mono_mass "1443.538621" xref: spec_1_neutral_loss_1444_avge_mass "1444.345" xref: spec_1_neutral_loss_1444_flag "false" xref: spec_1_neutral_loss_1444_composition "dHex(4) HexNAc(3) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1444_mono_mass "1443.538621" xref: spec_1_neutral_loss_1444_avge_mass "1444.345" xref: spec_1_neutral_loss_1444_flag "false" xref: spec_1_neutral_loss_1444_composition "dHex(4) HexNAc(3) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1705 name: Hex(2)HexNAc(1)NeuGc(3) def: "Hex(2) HexNAc NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1705] xref: record_id "1705" xref: delta_mono_mass "1448.456013" xref: delta_avge_mass "1449.2357" xref: delta_composition "Hex(2) HexNAc(1) NeuGc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1449_mono_mass "1448.456013" xref: spec_1_neutral_loss_1449_avge_mass "1449.2357" xref: spec_1_neutral_loss_1449_flag "false" xref: spec_1_neutral_loss_1449_composition "Hex(2) HexNAc(1) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1449_mono_mass "1448.456013" xref: spec_1_neutral_loss_1449_avge_mass "1449.2357" xref: spec_1_neutral_loss_1449_flag "false" xref: spec_1_neutral_loss_1449_composition "Hex(2) HexNAc(1) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1706 name: dHex(4)Hex(1)HexNAc(1)Kdn(2) def: "DHex(4) Hex HexNAc Kdn(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=1&hexnac=1&kdn=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1706] xref: record_id "1706" xref: delta_mono_mass "1449.501567" xref: delta_avge_mass "1450.3032" xref: delta_composition "dHex(4) Hex HexNAc Kdn(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1450_mono_mass "1449.501567" xref: spec_1_neutral_loss_1450_avge_mass "1450.3032" xref: spec_1_neutral_loss_1450_flag "false" xref: spec_1_neutral_loss_1450_composition "dHex(4) Hex HexNAc Kdn(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1450_mono_mass "1449.501567" xref: spec_1_neutral_loss_1450_avge_mass "1450.3032" xref: spec_1_neutral_loss_1450_flag "false" xref: spec_1_neutral_loss_1450_composition "dHex(4) Hex HexNAc Kdn(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1707 name: dHex(1)Hex(2)HexNAc(3)NeuAc(1)Sulf(1) def: "DHex Hex(2) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1707] xref: record_id "1707" xref: delta_mono_mass "1450.453905" xref: delta_avge_mass "1451.3177" xref: delta_composition "O(3) S dHex Hex(2) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:55:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1451_mono_mass "1450.453905" xref: spec_1_neutral_loss_1451_avge_mass "1451.3177" xref: spec_1_neutral_loss_1451_flag "false" xref: spec_1_neutral_loss_1451_composition "O(3) S dHex Hex(2) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1451_mono_mass "1450.453905" xref: spec_1_neutral_loss_1451_avge_mass "1451.3177" xref: spec_1_neutral_loss_1451_flag "false" xref: spec_1_neutral_loss_1451_composition "O(3) S dHex Hex(2) HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1708 name: dHex(1)Hex(2)HexNAc(2)NeuAc(2) def: "DHex Hex(2) HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1708] xref: record_id "1708" xref: delta_mono_mass "1458.513134" xref: delta_avge_mass "1459.3166" xref: delta_composition "dHex(1) Hex(2) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1459_mono_mass "1458.513134" xref: spec_1_neutral_loss_1459_avge_mass "1459.3166" xref: spec_1_neutral_loss_1459_flag "false" xref: spec_1_neutral_loss_1459_composition "dHex(1) Hex(2) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1459_mono_mass "1458.513134" xref: spec_1_neutral_loss_1459_avge_mass "1459.3166" xref: spec_1_neutral_loss_1459_flag "false" xref: spec_1_neutral_loss_1459_composition "dHex(1) Hex(2) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1709 name: dHex(3)Hex(1)HexNAc(3)Kdn(1) def: "DHex(3) Hex HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=1&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1709] xref: record_id "1709" xref: delta_mono_mass "1459.533535" xref: delta_avge_mass "1460.3444" xref: delta_composition "dHex(3) Hex HexNAc(3) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1460_mono_mass "1459.533535" xref: spec_1_neutral_loss_1460_avge_mass "1460.3444" xref: spec_1_neutral_loss_1460_flag "false" xref: spec_1_neutral_loss_1460_composition "dHex(3) Hex HexNAc(3) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1460_mono_mass "1459.533535" xref: spec_1_neutral_loss_1460_avge_mass "1460.3444" xref: spec_1_neutral_loss_1460_flag "false" xref: spec_1_neutral_loss_1460_composition "dHex(3) Hex HexNAc(3) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1711 name: Hex(3)HexNAc(3)NeuAc(1)Sulf(1) def: "Hex(3) HexNAc(3) NeuAc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1711] xref: record_id "1711" xref: delta_mono_mass "1466.44882" xref: delta_avge_mass "1467.3171" xref: delta_composition "O(3) S Hex(3) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:55:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1467_mono_mass "1466.44882" xref: spec_1_neutral_loss_1467_avge_mass "1467.3171" xref: spec_1_neutral_loss_1467_flag "false" xref: spec_1_neutral_loss_1467_composition "O(3) S Hex(3) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1467_mono_mass "1466.44882" xref: spec_1_neutral_loss_1467_avge_mass "1467.3171" xref: spec_1_neutral_loss_1467_flag "false" xref: spec_1_neutral_loss_1467_composition "O(3) S Hex(3) HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1712 name: Hex(3)HexNAc(2)NeuAc(2) def: "Hex(3) HexNAc(2) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1712] xref: record_id "1712" xref: delta_mono_mass "1474.508049" xref: delta_avge_mass "1475.316" xref: delta_composition "Hex(3) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1475_mono_mass "1474.508049" xref: spec_1_neutral_loss_1475_avge_mass "1475.316" xref: spec_1_neutral_loss_1475_flag "false" xref: spec_1_neutral_loss_1475_composition "Hex(3) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1475_mono_mass "1474.508049" xref: spec_1_neutral_loss_1475_avge_mass "1475.316" xref: spec_1_neutral_loss_1475_flag "false" xref: spec_1_neutral_loss_1475_composition "Hex(3) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1713 name: Hex(3)HexNAc(3)NeuGc(1)Sulf(1) def: "Hex(3) HexNAc(3) NeuGc Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1713] xref: record_id "1713" xref: delta_mono_mass "1482.443734" xref: delta_avge_mass "1483.3165" xref: delta_composition "O(3) S Hex(3) HexNAc(3) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:55:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1483_mono_mass "1482.443734" xref: spec_1_neutral_loss_1483_avge_mass "1483.3165" xref: spec_1_neutral_loss_1483_flag "false" xref: spec_1_neutral_loss_1483_composition "O(3) S Hex(3) HexNAc(3) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1483_mono_mass "1482.443734" xref: spec_1_neutral_loss_1483_avge_mass "1483.3165" xref: spec_1_neutral_loss_1483_flag "false" xref: spec_1_neutral_loss_1483_composition "O(3) S Hex(3) HexNAc(3) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1714 name: dHex(1)Hex(2)HexNAc(2)NeuGc(2) def: "DHex Hex(2) HexNAc(2) NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1714] xref: record_id "1714" xref: delta_mono_mass "1490.502964" xref: delta_avge_mass "1491.3154" xref: delta_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1491_mono_mass "1490.502964" xref: spec_1_neutral_loss_1491_avge_mass "1491.3154" xref: spec_1_neutral_loss_1491_flag "false" xref: spec_1_neutral_loss_1491_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1491_mono_mass "1490.502964" xref: spec_1_neutral_loss_1491_avge_mass "1491.3154" xref: spec_1_neutral_loss_1491_flag "false" xref: spec_1_neutral_loss_1491_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1715 name: dHex(2)Hex(3)HexNAc(2)NeuGc(1) def: "DHex(2) Hex(3) HexNAc(2) NeuGc ---OR--- Hex(4) HexNAc(2) dHex NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=2&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1715] xref: record_id "1715" xref: delta_mono_mass "1491.523365" xref: delta_avge_mass "1492.3432" xref: delta_composition "dHex(2) Hex(3) HexNAc(2) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 15:37:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1492_mono_mass "1491.523365" xref: spec_1_neutral_loss_1492_avge_mass "1492.3432" xref: spec_1_neutral_loss_1492_flag "false" xref: spec_1_neutral_loss_1492_composition "dHex(2) Hex(3) HexNAc(2) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1492_mono_mass "1491.523365" xref: spec_1_neutral_loss_1492_avge_mass "1492.3432" xref: spec_1_neutral_loss_1492_flag "false" xref: spec_1_neutral_loss_1492_composition "dHex(2) Hex(3) HexNAc(2) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1716 name: dHex(1)Hex(3)HexA(1)HexNAc(3)Sulf(1) def: "DHex Hex(3) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1716] xref: record_id "1716" xref: delta_mono_mass "1497.4434" xref: delta_avge_mass "1498.3279" xref: delta_composition "O(3) S dHex Hex(3) HexA HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:54:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1498_mono_mass "1497.4434" xref: spec_1_neutral_loss_1498_avge_mass "1498.3279" xref: spec_1_neutral_loss_1498_flag "false" xref: spec_1_neutral_loss_1498_composition "O(3) S dHex Hex(3) HexA HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1498_mono_mass "1497.4434" xref: spec_1_neutral_loss_1498_avge_mass "1498.3279" xref: spec_1_neutral_loss_1498_flag "false" xref: spec_1_neutral_loss_1498_composition "O(3) S dHex Hex(3) HexA HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1717 name: Hex(2)HexNAc(3)NeuAc(2) def: "Hex(2) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1717] xref: record_id "1717" xref: delta_mono_mass "1515.534598" xref: delta_avge_mass "1516.3679" xref: delta_composition "Hex(2) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1516_mono_mass "1515.534598" xref: spec_1_neutral_loss_1516_avge_mass "1516.3679" xref: spec_1_neutral_loss_1516_flag "false" xref: spec_1_neutral_loss_1516_composition "Hex(2) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1516_mono_mass "1515.534598" xref: spec_1_neutral_loss_1516_avge_mass "1516.3679" xref: spec_1_neutral_loss_1516_flag "false" xref: spec_1_neutral_loss_1516_composition "Hex(2) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1718 name: dHex(2)Hex(2)HexNAc(3)NeuAc(1) def: "DHex(2) Hex(2) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1718] xref: record_id "1718" xref: delta_mono_mass "1516.554999" xref: delta_avge_mass "1517.3957" xref: delta_composition "dHex(2) Hex(2) HexNAc(3) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1517_mono_mass "1516.554999" xref: spec_1_neutral_loss_1517_avge_mass "1517.3957" xref: spec_1_neutral_loss_1517_flag "false" xref: spec_1_neutral_loss_1517_composition "dHex(2) Hex(2) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1517_mono_mass "1516.554999" xref: spec_1_neutral_loss_1517_avge_mass "1517.3957" xref: spec_1_neutral_loss_1517_flag "false" xref: spec_1_neutral_loss_1517_composition "dHex(2) Hex(2) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1719 name: dHex(4)Hex(2)HexNAc(3) def: "DHex(4) Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1719] xref: record_id "1719" xref: delta_mono_mass "1517.5754" xref: delta_avge_mass "1518.4236" xref: delta_composition "dHex(4) Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1518_mono_mass "1517.5754" xref: spec_1_neutral_loss_1518_avge_mass "1518.4236" xref: spec_1_neutral_loss_1518_flag "false" xref: spec_1_neutral_loss_1518_composition "dHex(4) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1518_mono_mass "1517.5754" xref: spec_1_neutral_loss_1518_avge_mass "1518.4236" xref: spec_1_neutral_loss_1518_flag "false" xref: spec_1_neutral_loss_1518_composition "dHex(4) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1720 name: Hex(2)HexNAc(3)NeuAc(1)NeuGc(1) def: "Hex(2) HexNAc(3) NeuAc NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neuac=1&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1720] xref: record_id "1720" xref: delta_mono_mass "1531.529513" xref: delta_avge_mass "1532.3673" xref: delta_composition "Hex(2) HexNAc(3) NeuAc(1) NeuGc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1532_mono_mass "1531.529513" xref: spec_1_neutral_loss_1532_avge_mass "1532.3673" xref: spec_1_neutral_loss_1532_flag "false" xref: spec_1_neutral_loss_1532_composition "Hex(2) HexNAc(3) NeuAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1532_mono_mass "1531.529513" xref: spec_1_neutral_loss_1532_avge_mass "1532.3673" xref: spec_1_neutral_loss_1532_flag "false" xref: spec_1_neutral_loss_1532_composition "Hex(2) HexNAc(3) NeuAc(1) NeuGc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1721 name: dHex(2)Hex(2)HexNAc(3)NeuGc(1) def: "DHex(2) Hex(2) HexNAc(3) NeuGc ---OR--- Hex(3) HexNAc(3) dHex NeuAc ---OR--- Hex(2) HexNAc(4) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=3&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1721] xref: record_id "1721" xref: delta_mono_mass "1532.549914" xref: delta_avge_mass "1533.3951" xref: delta_composition "dHex(2) Hex(2) HexNAc(3) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 15:40:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1533_mono_mass "1532.549914" xref: spec_1_neutral_loss_1533_avge_mass "1533.3951" xref: spec_1_neutral_loss_1533_flag "false" xref: spec_1_neutral_loss_1533_composition "dHex(2) Hex(2) HexNAc(3) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1533_mono_mass "1532.549914" xref: spec_1_neutral_loss_1533_avge_mass "1533.3951" xref: spec_1_neutral_loss_1533_flag "false" xref: spec_1_neutral_loss_1533_composition "dHex(2) Hex(2) HexNAc(3) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1722 name: dHex(3)Hex(3)HexNAc(3) def: "DHex(3) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1722] xref: record_id "1722" xref: delta_mono_mass "1533.570315" xref: delta_avge_mass "1534.423" xref: delta_composition "dHex(3) Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1534_mono_mass "1533.570315" xref: spec_1_neutral_loss_1534_avge_mass "1534.423" xref: spec_1_neutral_loss_1534_flag "false" xref: spec_1_neutral_loss_1534_composition "dHex(3) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1534_mono_mass "1533.570315" xref: spec_1_neutral_loss_1534_avge_mass "1534.423" xref: spec_1_neutral_loss_1534_flag "false" xref: spec_1_neutral_loss_1534_composition "dHex(3) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1723 name: Hex(8)Phos(3) def: "Hex(8) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=8&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1723] xref: record_id "1723" xref: delta_mono_mass "1536.321581" xref: delta_avge_mass "1537.0645" xref: delta_composition "H(3) O(9) P(3) Hex(8)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:43:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1537_mono_mass "1536.321581" xref: spec_1_neutral_loss_1537_avge_mass "1537.0645" xref: spec_1_neutral_loss_1537_flag "false" xref: spec_1_neutral_loss_1537_composition "H(3) O(9) P(3) Hex(8)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1537_mono_mass "1536.321581" xref: spec_1_neutral_loss_1537_avge_mass "1537.0645" xref: spec_1_neutral_loss_1537_flag "false" xref: spec_1_neutral_loss_1537_composition "H(3) O(9) P(3) Hex(8)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1724 name: dHex(1)Hex(2)HexNAc(2)NeuAc(2)Sulf(1) def: "DHex Hex(2) HexNAc(2) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=2&hexnac=2&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1724] xref: record_id "1724" xref: delta_mono_mass "1538.469949" xref: delta_avge_mass "1539.3798" xref: delta_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:54:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1539_mono_mass "1538.469949" xref: spec_1_neutral_loss_1539_avge_mass "1539.3798" xref: spec_1_neutral_loss_1539_flag "false" xref: spec_1_neutral_loss_1539_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1539_mono_mass "1538.469949" xref: spec_1_neutral_loss_1539_avge_mass "1539.3798" xref: spec_1_neutral_loss_1539_flag "false" xref: spec_1_neutral_loss_1539_composition "O(3) S dHex Hex(2) HexNAc(2) NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1725 name: Hex(2)HexNAc(3)NeuGc(2) def: "Hex(2) HexNAc(3) NeuGc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neugc=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1725] xref: record_id "1725" xref: delta_mono_mass "1547.524427" xref: delta_avge_mass "1548.3667" xref: delta_composition "Hex(2) HexNAc(3) NeuGc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1548_mono_mass "1547.524427" xref: spec_1_neutral_loss_1548_avge_mass "1548.3667" xref: spec_1_neutral_loss_1548_flag "false" xref: spec_1_neutral_loss_1548_composition "Hex(2) HexNAc(3) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1548_mono_mass "1547.524427" xref: spec_1_neutral_loss_1548_avge_mass "1548.3667" xref: spec_1_neutral_loss_1548_flag "false" xref: spec_1_neutral_loss_1548_composition "Hex(2) HexNAc(3) NeuGc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1726 name: dHex(4)Hex(2)HexNAc(2)Kdn(1) def: "DHex(4) Hex(2) HexNAc(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=2&hexnac=2&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1726] xref: record_id "1726" xref: delta_mono_mass "1564.564895" xref: delta_avge_mass "1565.4337" xref: delta_composition "dHex(4) Hex(2) HexNAc(2) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:56:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1565_mono_mass "1564.564895" xref: spec_1_neutral_loss_1565_avge_mass "1565.4337" xref: spec_1_neutral_loss_1565_flag "false" xref: spec_1_neutral_loss_1565_composition "dHex(4) Hex(2) HexNAc(2) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1565_mono_mass "1564.564895" xref: spec_1_neutral_loss_1565_avge_mass "1565.4337" xref: spec_1_neutral_loss_1565_flag "false" xref: spec_1_neutral_loss_1565_composition "dHex(4) Hex(2) HexNAc(2) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1727 name: dHex(1)Hex(2)HexNAc(4)NeuAc(1) def: "DHex Hex(2) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1727] xref: record_id "1727" xref: delta_mono_mass "1573.576463" xref: delta_avge_mass "1574.4471" xref: delta_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1574_mono_mass "1573.576463" xref: spec_1_neutral_loss_1574_avge_mass "1574.4471" xref: spec_1_neutral_loss_1574_flag "false" xref: spec_1_neutral_loss_1574_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1574_mono_mass "1573.576463" xref: spec_1_neutral_loss_1574_avge_mass "1574.4471" xref: spec_1_neutral_loss_1574_flag "false" xref: spec_1_neutral_loss_1574_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1728 name: dHex(3)Hex(2)HexNAc(4) def: "DHex(3) Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1728] xref: record_id "1728" xref: delta_mono_mass "1574.596864" xref: delta_avge_mass "1575.4749" xref: delta_composition "dHex(3) Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1575_mono_mass "1574.596864" xref: spec_1_neutral_loss_1575_avge_mass "1575.4749" xref: spec_1_neutral_loss_1575_flag "false" xref: spec_1_neutral_loss_1575_composition "dHex(3) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1575_mono_mass "1574.596864" xref: spec_1_neutral_loss_1575_avge_mass "1575.4749" xref: spec_1_neutral_loss_1575_flag "false" xref: spec_1_neutral_loss_1575_composition "dHex(3) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1729 name: Hex(1)HexNAc(1)NeuGc(4) def: "Hex HexNAc NeuGc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1729] xref: record_id "1729" xref: delta_mono_mass "1593.493521" xref: delta_avge_mass "1594.349" xref: delta_composition "Hex(1) HexNAc(1) NeuGc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1594_mono_mass "1593.493521" xref: spec_1_neutral_loss_1594_avge_mass "1594.349" xref: spec_1_neutral_loss_1594_flag "false" xref: spec_1_neutral_loss_1594_composition "Hex(1) HexNAc(1) NeuGc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1594_mono_mass "1593.493521" xref: spec_1_neutral_loss_1594_avge_mass "1594.349" xref: spec_1_neutral_loss_1594_flag "false" xref: spec_1_neutral_loss_1594_composition "Hex(1) HexNAc(1) NeuGc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1730 name: dHex(4)Hex(1)HexNAc(3)Kdn(1) def: "DHex(4) Hex HexNAc(3) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=1&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1730] xref: record_id "1730" xref: delta_mono_mass "1605.591444" xref: delta_avge_mass "1606.4856" xref: delta_composition "dHex(4) Hex HexNAc(3) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 15:55:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1606_mono_mass "1605.591444" xref: spec_1_neutral_loss_1606_avge_mass "1606.4856" xref: spec_1_neutral_loss_1606_flag "false" xref: spec_1_neutral_loss_1606_composition "dHex(4) Hex HexNAc(3) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1606_mono_mass "1605.591444" xref: spec_1_neutral_loss_1606_avge_mass "1606.4856" xref: spec_1_neutral_loss_1606_flag "false" xref: spec_1_neutral_loss_1606_composition "dHex(4) Hex HexNAc(3) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1732 name: Hex(4)HexNAc(4)Sulf(2) def: "Hex(4) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1732] xref: record_id "1732" xref: delta_mono_mass "1620.442414" xref: delta_avge_mass "1621.4589" xref: delta_composition "O(6) S(2) Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 10:35:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1621_mono_mass "1620.442414" xref: spec_1_neutral_loss_1621_avge_mass "1621.4589" xref: spec_1_neutral_loss_1621_flag "false" xref: spec_1_neutral_loss_1621_composition "O(6) S(2) Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1621_mono_mass "1620.442414" xref: spec_1_neutral_loss_1621_avge_mass "1621.4589" xref: spec_1_neutral_loss_1621_flag "false" xref: spec_1_neutral_loss_1621_composition "O(6) S(2) Hex(4) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1733 name: dHex(3)Hex(2)HexNAc(3)Kdn(1) def: "DHex(3) Hex(2) HexNAc(3) Kdn ---OR--- Hex(3) HexNAc(2) dHex(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=2&hexnac=3&kdn=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1733] xref: record_id "1733" xref: delta_mono_mass "1621.586359" xref: delta_avge_mass "1622.485" xref: delta_composition "dHex(3) Hex(2) HexNAc(3) Kdn" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 10:37:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1622_mono_mass "1621.586359" xref: spec_1_neutral_loss_1622_avge_mass "1622.485" xref: spec_1_neutral_loss_1622_flag "false" xref: spec_1_neutral_loss_1622_composition "dHex(3) Hex(2) HexNAc(3) Kdn" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1622_mono_mass "1621.586359" xref: spec_1_neutral_loss_1622_avge_mass "1622.485" xref: spec_1_neutral_loss_1622_flag "false" xref: spec_1_neutral_loss_1622_composition "dHex(3) Hex(2) HexNAc(3) Kdn" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1735 name: dHex(2)Hex(2)HexNAc(5) def: "DHex(2) Hex(2) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1735] xref: record_id "1735" xref: delta_mono_mass "1631.618328" xref: delta_avge_mass "1632.5262" xref: delta_composition "dHex(2) Hex(2) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1632_mono_mass "1631.618328" xref: spec_1_neutral_loss_1632_avge_mass "1632.5262" xref: spec_1_neutral_loss_1632_flag "false" xref: spec_1_neutral_loss_1632_composition "dHex(2) Hex(2) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1632_mono_mass "1631.618328" xref: spec_1_neutral_loss_1632_avge_mass "1632.5262" xref: spec_1_neutral_loss_1632_flag "false" xref: spec_1_neutral_loss_1632_composition "dHex(2) Hex(2) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1736 name: dHex(2)Hex(3)HexA(1)HexNAc(3)Sulf(1) def: "DHex(2) Hex(3) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1736] xref: record_id "1736" xref: delta_mono_mass "1643.501309" xref: delta_avge_mass "1644.4691" xref: delta_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:54:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1644_mono_mass "1643.501309" xref: spec_1_neutral_loss_1644_avge_mass "1644.4691" xref: spec_1_neutral_loss_1644_flag "false" xref: spec_1_neutral_loss_1644_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1644_mono_mass "1643.501309" xref: spec_1_neutral_loss_1644_avge_mass "1644.4691" xref: spec_1_neutral_loss_1644_flag "false" xref: spec_1_neutral_loss_1644_composition "O(3) S dHex(2) Hex(3) HexA HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1737 name: dHex(1)Hex(4)HexA(1)HexNAc(3)Sulf(1) def: "DHex Hex(4) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=4&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1737] xref: record_id "1737" xref: delta_mono_mass "1659.496223" xref: delta_avge_mass "1660.4685" xref: delta_composition "O(3) S dHex Hex(4) HexA HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:54:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1660_mono_mass "1659.496223" xref: spec_1_neutral_loss_1660_avge_mass "1660.4685" xref: spec_1_neutral_loss_1660_flag "false" xref: spec_1_neutral_loss_1660_composition "O(3) S dHex Hex(4) HexA HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1660_mono_mass "1659.496223" xref: spec_1_neutral_loss_1660_avge_mass "1660.4685" xref: spec_1_neutral_loss_1660_flag "false" xref: spec_1_neutral_loss_1660_composition "O(3) S dHex Hex(4) HexA HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1738 name: Hex(3)HexNAc(3)NeuAc(2) def: "Hex(3) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1738] xref: record_id "1738" xref: delta_mono_mass "1677.587422" xref: delta_avge_mass "1678.5085" xref: delta_composition "Hex(3) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1678_mono_mass "1677.587422" xref: spec_1_neutral_loss_1678_avge_mass "1678.5085" xref: spec_1_neutral_loss_1678_flag "false" xref: spec_1_neutral_loss_1678_composition "Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1678_mono_mass "1677.587422" xref: spec_1_neutral_loss_1678_avge_mass "1678.5085" xref: spec_1_neutral_loss_1678_flag "false" xref: spec_1_neutral_loss_1678_composition "Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1739 name: dHex(2)Hex(3)HexNAc(3)NeuAc(1) def: "DHex(2) Hex(3) HexNAc(3) NeuAc ---OR--- Hex(2) HexNAc(4) dHex(2) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1739] xref: record_id "1739" xref: delta_mono_mass "1678.607823" xref: delta_avge_mass "1679.5363" xref: delta_composition "dHex(2) Hex(3) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 10:51:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1679_mono_mass "1678.607823" xref: spec_1_neutral_loss_1679_avge_mass "1679.5363" xref: spec_1_neutral_loss_1679_flag "false" xref: spec_1_neutral_loss_1679_composition "dHex(2) Hex(3) HexNAc(3) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1679_mono_mass "1678.607823" xref: spec_1_neutral_loss_1679_avge_mass "1679.5363" xref: spec_1_neutral_loss_1679_flag "false" xref: spec_1_neutral_loss_1679_composition "dHex(2) Hex(3) HexNAc(3) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1740 name: dHex(4)Hex(3)HexNAc(3) def: "DHex(4) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1740] xref: record_id "1740" xref: delta_mono_mass "1679.628224" xref: delta_avge_mass "1680.5642" xref: delta_composition "dHex(4) Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1680_mono_mass "1679.628224" xref: spec_1_neutral_loss_1680_avge_mass "1680.5642" xref: spec_1_neutral_loss_1680_flag "false" xref: spec_1_neutral_loss_1680_composition "dHex(4) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1680_mono_mass "1679.628224" xref: spec_1_neutral_loss_1680_avge_mass "1680.5642" xref: spec_1_neutral_loss_1680_flag "false" xref: spec_1_neutral_loss_1680_composition "dHex(4) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1742 name: Hex(9)Phos(3) def: "Hex(9) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=9&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1742] xref: record_id "1742" xref: delta_mono_mass "1698.374404" xref: delta_avge_mass "1699.2051" xref: delta_composition "H(3) O(9) P(3) Hex(9)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:47:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1699_mono_mass "1698.374404" xref: spec_1_neutral_loss_1699_avge_mass "1699.2051" xref: spec_1_neutral_loss_1699_flag "false" xref: spec_1_neutral_loss_1699_composition "H(3) O(9) P(3) Hex(9)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1699_mono_mass "1698.374404" xref: spec_1_neutral_loss_1699_avge_mass "1699.2051" xref: spec_1_neutral_loss_1699_flag "false" xref: spec_1_neutral_loss_1699_composition "H(3) O(9) P(3) Hex(9)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1743 name: dHex(2)HexNAc(7) def: "DHex(2) HexNAc(7)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hexnac=7&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1743] xref: record_id "1743" xref: delta_mono_mass "1713.671426" xref: delta_avge_mass "1714.63" xref: delta_composition "dHex(2) HexNAc(7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1714_mono_mass "1713.671426" xref: spec_1_neutral_loss_1714_avge_mass "1714.63" xref: spec_1_neutral_loss_1714_flag "false" xref: spec_1_neutral_loss_1714_composition "dHex(2) HexNAc(7)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1714_mono_mass "1713.671426" xref: spec_1_neutral_loss_1714_avge_mass "1714.63" xref: spec_1_neutral_loss_1714_flag "false" xref: spec_1_neutral_loss_1714_composition "dHex(2) HexNAc(7)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1744 name: Hex(2)HexNAc(1)NeuGc(4) def: "Hex(2) HexNAc NeuGc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=1&neugc=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1744] xref: record_id "1744" xref: delta_mono_mass "1755.546345" xref: delta_avge_mass "1756.4896" xref: delta_composition "Hex(2) HexNAc(1) NeuGc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1756_mono_mass "1755.546345" xref: spec_1_neutral_loss_1756_avge_mass "1756.4896" xref: spec_1_neutral_loss_1756_flag "false" xref: spec_1_neutral_loss_1756_composition "Hex(2) HexNAc(1) NeuGc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1756_mono_mass "1755.546345" xref: spec_1_neutral_loss_1756_avge_mass "1756.4896" xref: spec_1_neutral_loss_1756_flag "false" xref: spec_1_neutral_loss_1756_composition "Hex(2) HexNAc(1) NeuGc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1745 name: Hex(3)HexNAc(3)NeuAc(2)Sulf(1) def: "Hex(3) HexNAc(3) NeuAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1745] xref: record_id "1745" xref: delta_mono_mass "1757.544236" xref: delta_avge_mass "1758.5717" xref: delta_composition "O(3) S Hex(3) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:54:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1758_mono_mass "1757.544236" xref: spec_1_neutral_loss_1758_avge_mass "1758.5717" xref: spec_1_neutral_loss_1758_flag "false" xref: spec_1_neutral_loss_1758_composition "O(3) S Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1758_mono_mass "1757.544236" xref: spec_1_neutral_loss_1758_avge_mass "1758.5717" xref: spec_1_neutral_loss_1758_flag "false" xref: spec_1_neutral_loss_1758_composition "O(3) S Hex(3) HexNAc(3) NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1746 name: dHex(2)Hex(3)HexNAc(5) def: "DHex(2) Hex(3) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1746] xref: record_id "1746" xref: delta_mono_mass "1793.671151" xref: delta_avge_mass "1794.6668" xref: delta_composition "dHex(2) Hex(3) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-24 13:43:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1794_mono_mass "1793.671151" xref: spec_1_neutral_loss_1794_avge_mass "1794.6668" xref: spec_1_neutral_loss_1794_flag "false" xref: spec_1_neutral_loss_1794_composition "dHex(2) Hex(3) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1794_mono_mass "1793.671151" xref: spec_1_neutral_loss_1794_avge_mass "1794.6668" xref: spec_1_neutral_loss_1794_flag "false" xref: spec_1_neutral_loss_1794_composition "dHex(2) Hex(3) HexNAc(5)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1794_mono_mass "1793.671151" xref: spec_2_neutral_loss_1794_avge_mass "1794.6668" xref: spec_2_neutral_loss_1794_flag "false" xref: spec_2_neutral_loss_1794_composition "dHex(2) Hex(3) HexNAc(5)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1747 name: dHex(1)Hex(2)HexNAc(2)NeuGc(3) def: "DHex Hex(2) HexNAc(2) NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=2&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1747] xref: record_id "1747" xref: delta_mono_mass "1797.593295" xref: delta_avge_mass "1798.5694" xref: delta_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1798_mono_mass "1797.593295" xref: spec_1_neutral_loss_1798_avge_mass "1798.5694" xref: spec_1_neutral_loss_1798_flag "false" xref: spec_1_neutral_loss_1798_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1798_mono_mass "1797.593295" xref: spec_1_neutral_loss_1798_avge_mass "1798.5694" xref: spec_1_neutral_loss_1798_flag "false" xref: spec_1_neutral_loss_1798_composition "dHex(1) Hex(2) HexNAc(2) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1748 name: dHex(2)Hex(4)HexA(1)HexNAc(3)Sulf(1) def: "DHex(2) Hex(4) HexA HexNAc(3) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=4&hexa=1&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1748] xref: record_id "1748" xref: delta_mono_mass "1805.554132" xref: delta_avge_mass "1806.6097" xref: delta_composition "O(3) S dHex(2) Hex(4) HexA HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:53:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1806_mono_mass "1805.554132" xref: spec_1_neutral_loss_1806_avge_mass "1806.6097" xref: spec_1_neutral_loss_1806_flag "false" xref: spec_1_neutral_loss_1806_composition "O(3) S dHex(2) Hex(4) HexA HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1806_mono_mass "1805.554132" xref: spec_1_neutral_loss_1806_avge_mass "1806.6097" xref: spec_1_neutral_loss_1806_flag "false" xref: spec_1_neutral_loss_1806_composition "O(3) S dHex(2) Hex(4) HexA HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1749 name: Hex(2)HexNAc(3)NeuAc(3) def: "Hex(2) HexNAc(3) NeuAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1749] xref: record_id "1749" xref: delta_mono_mass "1806.630015" xref: delta_avge_mass "1807.6225" xref: delta_composition "Hex(2) HexNAc(3) NeuAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1807_mono_mass "1806.630015" xref: spec_1_neutral_loss_1807_avge_mass "1807.6225" xref: spec_1_neutral_loss_1807_flag "false" xref: spec_1_neutral_loss_1807_composition "Hex(2) HexNAc(3) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1807_mono_mass "1806.630015" xref: spec_1_neutral_loss_1807_avge_mass "1807.6225" xref: spec_1_neutral_loss_1807_flag "false" xref: spec_1_neutral_loss_1807_composition "Hex(2) HexNAc(3) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1750 name: dHex(1)Hex(3)HexNAc(3)NeuAc(2) def: "DHex Hex(3) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1750] xref: record_id "1750" xref: delta_mono_mass "1823.64533" xref: delta_avge_mass "1824.6497" xref: delta_composition "dHex(1) Hex(3) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1824_mono_mass "1823.64533" xref: spec_1_neutral_loss_1824_avge_mass "1824.6497" xref: spec_1_neutral_loss_1824_flag "false" xref: spec_1_neutral_loss_1824_composition "dHex(1) Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1824_mono_mass "1823.64533" xref: spec_1_neutral_loss_1824_avge_mass "1824.6497" xref: spec_1_neutral_loss_1824_flag "false" xref: spec_1_neutral_loss_1824_composition "dHex(1) Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1751 name: dHex(3)Hex(3)HexNAc(3)NeuAc(1) def: "DHex(3) Hex(3) HexNAc(3) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1751] xref: record_id "1751" xref: delta_mono_mass "1824.665732" xref: delta_avge_mass "1825.6775" xref: delta_composition "dHex(3) Hex(3) HexNAc(3) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1825_mono_mass "1824.665732" xref: spec_1_neutral_loss_1825_avge_mass "1825.6775" xref: spec_1_neutral_loss_1825_flag "false" xref: spec_1_neutral_loss_1825_composition "dHex(3) Hex(3) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1825_mono_mass "1824.665732" xref: spec_1_neutral_loss_1825_avge_mass "1825.6775" xref: spec_1_neutral_loss_1825_flag "false" xref: spec_1_neutral_loss_1825_composition "dHex(3) Hex(3) HexNAc(3) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1752 name: Hex(2)HexNAc(3)NeuGc(3) def: "Hex(2) HexNAc(3) NeuGc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=2&hexnac=3&neugc=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1752] xref: record_id "1752" xref: delta_mono_mass "1854.614759" xref: delta_avge_mass "1855.6207" xref: delta_composition "Hex(2) HexNAc(3) NeuGc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1855_mono_mass "1854.614759" xref: spec_1_neutral_loss_1855_avge_mass "1855.6207" xref: spec_1_neutral_loss_1855_flag "false" xref: spec_1_neutral_loss_1855_composition "Hex(2) HexNAc(3) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1855_mono_mass "1854.614759" xref: spec_1_neutral_loss_1855_avge_mass "1855.6207" xref: spec_1_neutral_loss_1855_flag "false" xref: spec_1_neutral_loss_1855_composition "Hex(2) HexNAc(3) NeuGc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1753 name: Hex(10)Phos(3) def: "Hex(10) Phos(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?phosphate=3&hex=10&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1753] xref: record_id "1753" xref: delta_mono_mass "1860.427228" xref: delta_avge_mass "1861.3457" xref: delta_composition "H(3) O(9) P(3) Hex(10)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:51:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1861_mono_mass "1860.427228" xref: spec_1_neutral_loss_1861_avge_mass "1861.3457" xref: spec_1_neutral_loss_1861_flag "false" xref: spec_1_neutral_loss_1861_composition "H(3) O(9) P(3) Hex(10)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1861_mono_mass "1860.427228" xref: spec_1_neutral_loss_1861_avge_mass "1861.3457" xref: spec_1_neutral_loss_1861_flag "false" xref: spec_1_neutral_loss_1861_composition "H(3) O(9) P(3) Hex(10)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1754 name: dHex(1)Hex(2)HexNAc(4)NeuAc(2) def: "DHex Hex(2) HexNAc(4) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1754] xref: record_id "1754" xref: delta_mono_mass "1864.67188" xref: delta_avge_mass "1865.7016" xref: delta_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1865_mono_mass "1864.67188" xref: spec_1_neutral_loss_1865_avge_mass "1865.7016" xref: spec_1_neutral_loss_1865_flag "false" xref: spec_1_neutral_loss_1865_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1865_mono_mass "1864.67188" xref: spec_1_neutral_loss_1865_avge_mass "1865.7016" xref: spec_1_neutral_loss_1865_flag "false" xref: spec_1_neutral_loss_1865_composition "dHex(1) Hex(2) HexNAc(4) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1755 name: Hex(1)HexNAc(1)NeuGc(5) def: "Hex HexNAc NeuGc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=1&hexnac=1&neugc=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1755] xref: record_id "1755" xref: delta_mono_mass "1900.583852" xref: delta_avge_mass "1901.603" xref: delta_composition "Hex(1) HexNAc(1) NeuGc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1901_mono_mass "1900.583852" xref: spec_1_neutral_loss_1901_avge_mass "1901.603" xref: spec_1_neutral_loss_1901_flag "false" xref: spec_1_neutral_loss_1901_composition "Hex(1) HexNAc(1) NeuGc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1901_mono_mass "1900.583852" xref: spec_1_neutral_loss_1901_avge_mass "1901.603" xref: spec_1_neutral_loss_1901_flag "false" xref: spec_1_neutral_loss_1901_composition "Hex(1) HexNAc(1) NeuGc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1756 name: Hex(4)HexNAc(4)NeuAc(1)Sulf(2) def: "Hex(4) HexNAc(4) NeuAc Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1756] xref: record_id "1756" xref: delta_mono_mass "1911.53783" xref: delta_avge_mass "1912.7135" xref: delta_composition "O(6) S(2) Hex(4) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:50:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1912_mono_mass "1911.53783" xref: spec_1_neutral_loss_1912_avge_mass "1912.7135" xref: spec_1_neutral_loss_1912_flag "false" xref: spec_1_neutral_loss_1912_composition "O(6) S(2) Hex(4) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1912_mono_mass "1911.53783" xref: spec_1_neutral_loss_1912_avge_mass "1912.7135" xref: spec_1_neutral_loss_1912_flag "false" xref: spec_1_neutral_loss_1912_composition "O(6) S(2) Hex(4) HexNAc(4) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1757 name: Hex(4)HexNAc(4)NeuGc(1)Sulf(2) def: "Hex(4) HexNAc(4) NeuGc Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&hex=4&hexnac=4&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1757] xref: record_id "1757" xref: delta_mono_mass "1927.532745" xref: delta_avge_mass "1928.7129" xref: delta_composition "O(6) S(2) Hex(4) HexNAc(4) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:50:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1928_mono_mass "1927.532745" xref: spec_1_neutral_loss_1928_avge_mass "1928.7129" xref: spec_1_neutral_loss_1928_flag "false" xref: spec_1_neutral_loss_1928_composition "O(6) S(2) Hex(4) HexNAc(4) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1928_mono_mass "1927.532745" xref: spec_1_neutral_loss_1928_avge_mass "1928.7129" xref: spec_1_neutral_loss_1928_flag "false" xref: spec_1_neutral_loss_1928_composition "O(6) S(2) Hex(4) HexNAc(4) NeuGc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1758 name: dHex(2)Hex(3)HexNAc(3)NeuAc(2) def: "DHex(2) Hex(3) HexNAc(3) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1758] xref: record_id "1758" xref: delta_mono_mass "1969.703239" xref: delta_avge_mass "1970.7909" xref: delta_composition "dHex(2) Hex(3) HexNAc(3) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1970_mono_mass "1969.703239" xref: spec_1_neutral_loss_1970_avge_mass "1970.7909" xref: spec_1_neutral_loss_1970_flag "false" xref: spec_1_neutral_loss_1970_composition "dHex(2) Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1970_mono_mass "1969.703239" xref: spec_1_neutral_loss_1970_avge_mass "1970.7909" xref: spec_1_neutral_loss_1970_flag "false" xref: spec_1_neutral_loss_1970_composition "dHex(2) Hex(3) HexNAc(3) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1759 name: Hex(4)HexNAc(4)NeuAc(1)Sulf(3) def: "Hex(4) HexNAc(4) NeuAc Sulf(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=3&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1759] xref: record_id "1759" xref: delta_mono_mass "1991.494645" xref: delta_avge_mass "1992.7767" xref: delta_composition "O(9) S(3) Hex(4) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:50:03" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1992_mono_mass "1991.494645" xref: spec_1_neutral_loss_1992_avge_mass "1992.7767" xref: spec_1_neutral_loss_1992_flag "false" xref: spec_1_neutral_loss_1992_composition "O(9) S(3) Hex(4) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1992_mono_mass "1991.494645" xref: spec_1_neutral_loss_1992_avge_mass "1992.7767" xref: spec_1_neutral_loss_1992_flag "false" xref: spec_1_neutral_loss_1992_composition "O(9) S(3) Hex(4) HexNAc(4) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1760 name: dHex(2)Hex(2)HexNAc(2) def: "DHex(2) Hex(2) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1760] xref: record_id "1760" xref: delta_mono_mass "1022.38021" xref: delta_avge_mass "1022.9486" xref: delta_composition "dHex(2) Hex(2) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1023_mono_mass "1022.38021" xref: spec_1_neutral_loss_1023_avge_mass "1022.9486" xref: spec_1_neutral_loss_1023_flag "false" xref: spec_1_neutral_loss_1023_composition "dHex(2) Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1023_mono_mass "1022.38021" xref: spec_1_neutral_loss_1023_avge_mass "1022.9486" xref: spec_1_neutral_loss_1023_flag "false" xref: spec_1_neutral_loss_1023_composition "dHex(2) Hex(2) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1023_mono_mass "1022.38021" xref: spec_2_neutral_loss_1023_avge_mass "1022.9486" xref: spec_2_neutral_loss_1023_flag "false" xref: spec_2_neutral_loss_1023_composition "dHex(2) Hex(2) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1761 name: dHex(1)Hex(3)HexNAc(2) def: "DHex Hex(3) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1761] xref: record_id "1761" xref: delta_mono_mass "1038.375125" xref: delta_avge_mass "1038.948" xref: delta_composition "dHex(1) Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1039_mono_mass "1038.375125" xref: spec_1_neutral_loss_1039_avge_mass "1038.948" xref: spec_1_neutral_loss_1039_flag "false" xref: spec_1_neutral_loss_1039_composition "dHex(1) Hex(3) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1039_mono_mass "1038.375125" xref: spec_1_neutral_loss_1039_avge_mass "1038.948" xref: spec_1_neutral_loss_1039_flag "false" xref: spec_1_neutral_loss_1039_composition "dHex(1) Hex(3) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1039_mono_mass "1038.375125" xref: spec_2_neutral_loss_1039_avge_mass "1038.948" xref: spec_2_neutral_loss_1039_flag "false" xref: spec_2_neutral_loss_1039_composition "dHex(1) Hex(3) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1762 name: dHex(1)Hex(2)HexNAc(3) def: "DHex Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1762] xref: record_id "1762" xref: delta_mono_mass "1079.401674" xref: delta_avge_mass "1080" xref: delta_composition "dHex(1) Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1080_mono_mass "1079.401674" xref: spec_1_neutral_loss_1080_avge_mass "1080" xref: spec_1_neutral_loss_1080_flag "false" xref: spec_1_neutral_loss_1080_composition "dHex(1) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1080_mono_mass "1079.401674" xref: spec_1_neutral_loss_1080_avge_mass "1080" xref: spec_1_neutral_loss_1080_flag "false" xref: spec_1_neutral_loss_1080_composition "dHex(1) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1080_mono_mass "1079.401674" xref: spec_2_neutral_loss_1080_avge_mass "1080" xref: spec_2_neutral_loss_1080_flag "false" xref: spec_2_neutral_loss_1080_composition "dHex(1) Hex(2) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1763 name: Hex(3)HexNAc(3) def: "Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1763] xref: record_id "1763" xref: delta_mono_mass "1095.396588" xref: delta_avge_mass "1095.9994" xref: delta_composition "Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1096_mono_mass "1095.396588" xref: spec_1_neutral_loss_1096_avge_mass "1095.9994" xref: spec_1_neutral_loss_1096_flag "false" xref: spec_1_neutral_loss_1096_composition "Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1096_mono_mass "1095.396588" xref: spec_1_neutral_loss_1096_avge_mass "1095.9994" xref: spec_1_neutral_loss_1096_flag "false" xref: spec_1_neutral_loss_1096_composition "Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1096_mono_mass "1095.396588" xref: spec_2_neutral_loss_1096_avge_mass "1095.9994" xref: spec_2_neutral_loss_1096_flag "false" xref: spec_2_neutral_loss_1096_composition "Hex(3) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1764 name: dHex(1)Hex(3)HexNAc(2)Sulf(1) def: "DHex Hex(3) HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1764] xref: record_id "1764" xref: delta_mono_mass "1118.331939" xref: delta_avge_mass "1119.0112" xref: delta_composition "O(3) S dHex Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-06 09:49:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1119_mono_mass "1118.331939" xref: spec_1_neutral_loss_1119_avge_mass "1119.0112" xref: spec_1_neutral_loss_1119_flag "false" xref: spec_1_neutral_loss_1119_composition "O(3) S dHex Hex(3) HexNAc(2)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1119_mono_mass "1118.331939" xref: spec_1_neutral_loss_1119_avge_mass "1119.0112" xref: spec_1_neutral_loss_1119_flag "false" xref: spec_1_neutral_loss_1119_composition "O(3) S dHex Hex(3) HexNAc(2)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1119_mono_mass "1118.331939" xref: spec_2_neutral_loss_1119_avge_mass "1119.0112" xref: spec_2_neutral_loss_1119_flag "false" xref: spec_2_neutral_loss_1119_composition "O(3) S dHex Hex(3) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1765 name: dHex(2)Hex(3)HexNAc(2) def: "DHex(2) Hex(3) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1765] xref: record_id "1765" xref: delta_mono_mass "1184.433033" xref: delta_avge_mass "1185.0892" xref: delta_composition "dHex(2) Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1185_mono_mass "1184.433033" xref: spec_1_neutral_loss_1185_avge_mass "1185.0892" xref: spec_1_neutral_loss_1185_flag "false" xref: spec_1_neutral_loss_1185_composition "dHex(2) Hex(3) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1185_mono_mass "1184.433033" xref: spec_1_neutral_loss_1185_avge_mass "1185.0892" xref: spec_1_neutral_loss_1185_flag "false" xref: spec_1_neutral_loss_1185_composition "dHex(2) Hex(3) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1185_mono_mass "1184.433033" xref: spec_2_neutral_loss_1185_avge_mass "1185.0892" xref: spec_2_neutral_loss_1185_flag "false" xref: spec_2_neutral_loss_1185_composition "dHex(2) Hex(3) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1766 name: dHex(1)Hex(4)HexNAc(2) def: "DHex Hex(4) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hexac=2&mode=exact, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1766] xref: record_id "1766" xref: delta_mono_mass "1200.427948" xref: delta_avge_mass "1201.0886" xref: delta_composition "dHex(1) Hex(4) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1201_mono_mass "1200.427948" xref: spec_1_neutral_loss_1201_avge_mass "1201.0886" xref: spec_1_neutral_loss_1201_flag "false" xref: spec_1_neutral_loss_1201_composition "dHex(1) Hex(4) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1201_mono_mass "1200.427948" xref: spec_1_neutral_loss_1201_avge_mass "1201.0886" xref: spec_1_neutral_loss_1201_flag "false" xref: spec_1_neutral_loss_1201_composition "dHex(1) Hex(4) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1201_mono_mass "1200.427948" xref: spec_2_neutral_loss_1201_avge_mass "1201.0886" xref: spec_2_neutral_loss_1201_flag "false" xref: spec_2_neutral_loss_1201_composition "dHex(1) Hex(4) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1767 name: dHex(2)Hex(2)HexNAc(3) def: "DHex(2) Hex(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1767] xref: record_id "1767" xref: delta_mono_mass "1225.459583" xref: delta_avge_mass "1226.1412" xref: delta_composition "dHex(2) Hex(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1226_mono_mass "1225.459583" xref: spec_1_neutral_loss_1226_avge_mass "1226.1412" xref: spec_1_neutral_loss_1226_flag "false" xref: spec_1_neutral_loss_1226_composition "dHex(2) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1226_mono_mass "1225.459583" xref: spec_1_neutral_loss_1226_avge_mass "1226.1412" xref: spec_1_neutral_loss_1226_flag "false" xref: spec_1_neutral_loss_1226_composition "dHex(2) Hex(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1226_mono_mass "1225.459583" xref: spec_2_neutral_loss_1226_avge_mass "1226.1412" xref: spec_2_neutral_loss_1226_flag "false" xref: spec_2_neutral_loss_1226_composition "dHex(2) Hex(2) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1768 name: dHex(1)Hex(3)HexNAc(3) def: "DHex Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1768] xref: record_id "1768" xref: delta_mono_mass "1241.454497" xref: delta_avge_mass "1242.1406" xref: delta_composition "dHex(1) Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1242_mono_mass "1241.454497" xref: spec_1_neutral_loss_1242_avge_mass "1242.1406" xref: spec_1_neutral_loss_1242_flag "false" xref: spec_1_neutral_loss_1242_composition "dHex(1) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1242_mono_mass "1241.454497" xref: spec_1_neutral_loss_1242_avge_mass "1242.1406" xref: spec_1_neutral_loss_1242_flag "false" xref: spec_1_neutral_loss_1242_composition "dHex(1) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1242_mono_mass "1241.454497" xref: spec_2_neutral_loss_1242_avge_mass "1242.1406" xref: spec_2_neutral_loss_1242_flag "false" xref: spec_2_neutral_loss_1242_composition "dHex(1) Hex(3) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1769 name: Hex(4)HexNAc(3) def: "Hex(4) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1769] xref: record_id "1769" xref: delta_mono_mass "1257.449412" xref: delta_avge_mass "1258.14" xref: delta_composition "Hex(4) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1258_mono_mass "1257.449412" xref: spec_1_neutral_loss_1258_avge_mass "1258.14" xref: spec_1_neutral_loss_1258_flag "false" xref: spec_1_neutral_loss_1258_composition "Hex(4) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1258_mono_mass "1257.449412" xref: spec_1_neutral_loss_1258_avge_mass "1258.14" xref: spec_1_neutral_loss_1258_flag "false" xref: spec_1_neutral_loss_1258_composition "Hex(4) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1258_mono_mass "1257.449412" xref: spec_2_neutral_loss_1258_avge_mass "1258.14" xref: spec_2_neutral_loss_1258_flag "false" xref: spec_2_neutral_loss_1258_composition "Hex(4) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1770 name: dHex(2)Hex(4)HexNAc(2) def: "DHex(2) Hex(4) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1770] xref: record_id "1770" xref: delta_mono_mass "1346.485857" xref: delta_avge_mass "1347.2298" xref: delta_composition "dHex(2) Hex(4) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1347_mono_mass "1346.485857" xref: spec_1_neutral_loss_1347_avge_mass "1347.2298" xref: spec_1_neutral_loss_1347_flag "false" xref: spec_1_neutral_loss_1347_composition "dHex(2) Hex(4) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1347_mono_mass "1346.485857" xref: spec_1_neutral_loss_1347_avge_mass "1347.2298" xref: spec_1_neutral_loss_1347_flag "false" xref: spec_1_neutral_loss_1347_composition "dHex(2) Hex(4) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1347_mono_mass "1346.485857" xref: spec_2_neutral_loss_1347_avge_mass "1347.2298" xref: spec_2_neutral_loss_1347_flag "false" xref: spec_2_neutral_loss_1347_composition "dHex(2) Hex(4) HexNAc(2)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1771 name: dHex(2)Hex(3)HexNAc(3) def: "DHex(2) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1771] xref: record_id "1771" xref: delta_mono_mass "1387.512406" xref: delta_avge_mass "1388.2818" xref: delta_composition "dHex(2) Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1388_mono_mass "1387.512406" xref: spec_1_neutral_loss_1388_avge_mass "1388.2818" xref: spec_1_neutral_loss_1388_flag "false" xref: spec_1_neutral_loss_1388_composition "dHex(2) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1388_mono_mass "1387.512406" xref: spec_1_neutral_loss_1388_avge_mass "1388.2818" xref: spec_1_neutral_loss_1388_flag "false" xref: spec_1_neutral_loss_1388_composition "dHex(2) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1388_mono_mass "1387.512406" xref: spec_2_neutral_loss_1388_avge_mass "1388.2818" xref: spec_2_neutral_loss_1388_flag "false" xref: spec_2_neutral_loss_1388_composition "dHex(2) Hex(3) HexNAc(3)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1772 name: Hex(3)HexNAc(5) def: "A3." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1772] xref: record_id "1772" xref: delta_mono_mass "1501.555334" xref: delta_avge_mass "1502.3844" xref: delta_composition "Hex(3) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:46:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1502_mono_mass "1501.555334" xref: spec_1_neutral_loss_1502_avge_mass "1502.3844" xref: spec_1_neutral_loss_1502_flag "false" xref: spec_1_neutral_loss_1502_composition "Hex(3) HexNAc(5)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1502_mono_mass "1501.555334" xref: spec_1_neutral_loss_1502_avge_mass "1502.3844" xref: spec_1_neutral_loss_1502_flag "false" xref: spec_1_neutral_loss_1502_composition "Hex(3) HexNAc(5)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1502_mono_mass "1501.555334" xref: spec_2_neutral_loss_1502_avge_mass "1502.3844" xref: spec_2_neutral_loss_1502_flag "false" xref: spec_2_neutral_loss_1502_composition "Hex(3) HexNAc(5)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1773 name: Hex(4)HexNAc(3)NeuAc(1) def: "Hex(4) HexNAc(3) NeuAc ---OR--- Hex(3) HexNAc(4) Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=3&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1773] xref: record_id "1773" xref: delta_mono_mass "1548.544828" xref: delta_avge_mass "1549.3945" xref: delta_composition "Hex(4) HexNAc(3) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-17 15:42:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1549_mono_mass "1548.544828" xref: spec_1_neutral_loss_1549_avge_mass "1549.3945" xref: spec_1_neutral_loss_1549_flag "false" xref: spec_1_neutral_loss_1549_composition "Hex(4) HexNAc(3) NeuAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1549_mono_mass "1548.544828" xref: spec_1_neutral_loss_1549_avge_mass "1549.3945" xref: spec_1_neutral_loss_1549_flag "false" xref: spec_1_neutral_loss_1549_composition "Hex(4) HexNAc(3) NeuAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1549_mono_mass "1548.544828" xref: spec_2_neutral_loss_1549_avge_mass "1549.3945" xref: spec_2_neutral_loss_1549_flag "false" xref: spec_2_neutral_loss_1549_composition "Hex(4) HexNAc(3) NeuAc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1774 name: dHex(2)Hex(3)HexNAc(4) def: "DHex(2) Hex(3) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1774] xref: record_id "1774" xref: delta_mono_mass "1590.591779" xref: delta_avge_mass "1591.4743" xref: delta_composition "dHex(2) Hex(3) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1591_mono_mass "1590.591779" xref: spec_1_neutral_loss_1591_avge_mass "1591.4743" xref: spec_1_neutral_loss_1591_flag "false" xref: spec_1_neutral_loss_1591_composition "dHex(2) Hex(3) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1591_mono_mass "1590.591779" xref: spec_1_neutral_loss_1591_avge_mass "1591.4743" xref: spec_1_neutral_loss_1591_flag "false" xref: spec_1_neutral_loss_1591_composition "dHex(2) Hex(3) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1591_mono_mass "1590.591779" xref: spec_2_neutral_loss_1591_avge_mass "1591.4743" xref: spec_2_neutral_loss_1591_flag "false" xref: spec_2_neutral_loss_1591_composition "dHex(2) Hex(3) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1775 name: dHex(1)Hex(3)HexNAc(5) def: "DHex Hex(3) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1775] xref: record_id "1775" xref: delta_mono_mass "1647.613242" xref: delta_avge_mass "1648.5256" xref: delta_composition "dHex(1) Hex(3) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1648_mono_mass "1647.613242" xref: spec_1_neutral_loss_1648_avge_mass "1648.5256" xref: spec_1_neutral_loss_1648_flag "false" xref: spec_1_neutral_loss_1648_composition "dHex(1) Hex(3) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1648_mono_mass "1647.613242" xref: spec_1_neutral_loss_1648_avge_mass "1648.5256" xref: spec_1_neutral_loss_1648_flag "false" xref: spec_1_neutral_loss_1648_composition "dHex(1) Hex(3) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1648_mono_mass "1647.613242" xref: spec_2_neutral_loss_1648_avge_mass "1648.5256" xref: spec_2_neutral_loss_1648_flag "false" xref: spec_2_neutral_loss_1648_composition "dHex(1) Hex(3) HexNAc(5)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1776 name: Hex(3)HexNAc(6) def: "A4." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1776] xref: record_id "1776" xref: delta_mono_mass "1704.634706" xref: delta_avge_mass "1705.5769" xref: delta_composition "Hex(3) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2020-08-02 11:48:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1705_mono_mass "1704.634706" xref: spec_1_neutral_loss_1705_avge_mass "1705.5769" xref: spec_1_neutral_loss_1705_flag "false" xref: spec_1_neutral_loss_1705_composition "Hex(3) HexNAc(6)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1705_mono_mass "1704.634706" xref: spec_1_neutral_loss_1705_avge_mass "1705.5769" xref: spec_1_neutral_loss_1705_flag "false" xref: spec_1_neutral_loss_1705_composition "Hex(3) HexNAc(6)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1705_mono_mass "1704.634706" xref: spec_2_neutral_loss_1705_avge_mass "1705.5769" xref: spec_2_neutral_loss_1705_flag "false" xref: spec_2_neutral_loss_1705_composition "Hex(3) HexNAc(6)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1777 name: Hex(4)HexNAc(4)NeuAc(1) def: "Hex(4) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1777] xref: record_id "1777" xref: delta_mono_mass "1751.624201" xref: delta_avge_mass "1752.5871" xref: delta_composition "Hex(4) HexNAc(4) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1752_mono_mass "1751.624201" xref: spec_1_neutral_loss_1752_avge_mass "1752.5871" xref: spec_1_neutral_loss_1752_flag "false" xref: spec_1_neutral_loss_1752_composition "Hex(4) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1752_mono_mass "1751.624201" xref: spec_1_neutral_loss_1752_avge_mass "1752.5871" xref: spec_1_neutral_loss_1752_flag "false" xref: spec_1_neutral_loss_1752_composition "Hex(4) HexNAc(4) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1752_mono_mass "1751.624201" xref: spec_2_neutral_loss_1752_avge_mass "1752.5871" xref: spec_2_neutral_loss_1752_flag "false" xref: spec_2_neutral_loss_1752_composition "Hex(4) HexNAc(4) NeuAc(1)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1778 name: dHex(2)Hex(4)HexNAc(4) def: "DHex(2) Hex(4) HexNAc(4) ---OR--- Hex(4) HexNAc(4) dHex Pent Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1778] xref: record_id "1778" xref: delta_mono_mass "1752.644602" xref: delta_avge_mass "1753.6149" xref: delta_composition "dHex(2) Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 11:07:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1753_mono_mass "1752.644602" xref: spec_1_neutral_loss_1753_avge_mass "1753.6149" xref: spec_1_neutral_loss_1753_flag "false" xref: spec_1_neutral_loss_1753_composition "dHex(2) Hex(4) HexNAc(4)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1753_mono_mass "1752.644602" xref: spec_1_neutral_loss_1753_avge_mass "1753.6149" xref: spec_1_neutral_loss_1753_flag "false" xref: spec_1_neutral_loss_1753_composition "dHex(2) Hex(4) HexNAc(4)" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1753_mono_mass "1752.644602" xref: spec_2_neutral_loss_1753_avge_mass "1753.6149" xref: spec_2_neutral_loss_1753_flag "false" xref: spec_2_neutral_loss_1753_composition "dHex(2) Hex(4) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1779 name: Hex(6)HexNAc(4) def: "Hex(6) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1779] xref: record_id "1779" xref: delta_mono_mass "1784.634431" xref: delta_avge_mass "1785.6137" xref: delta_composition "Hex(6) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1785_mono_mass "1784.634431" xref: spec_1_neutral_loss_1785_avge_mass "1785.6137" xref: spec_1_neutral_loss_1785_flag "false" xref: spec_1_neutral_loss_1785_composition "Hex(6) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1785_mono_mass "1784.634431" xref: spec_1_neutral_loss_1785_avge_mass "1785.6137" xref: spec_1_neutral_loss_1785_flag "false" xref: spec_1_neutral_loss_1785_composition "Hex(6) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1785_mono_mass "1784.634431" xref: spec_2_neutral_loss_1785_avge_mass "1785.6137" xref: spec_2_neutral_loss_1785_flag "false" xref: spec_2_neutral_loss_1785_composition "Hex(6) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1780 name: Hex(5)HexNAc(5) def: "Hex(5) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1780] xref: record_id "1780" xref: delta_mono_mass "1825.660981" xref: delta_avge_mass "1826.6656" xref: delta_composition "Hex(5) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1826_mono_mass "1825.660981" xref: spec_1_neutral_loss_1826_avge_mass "1826.6656" xref: spec_1_neutral_loss_1826_flag "false" xref: spec_1_neutral_loss_1826_composition "Hex(5) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1826_mono_mass "1825.660981" xref: spec_1_neutral_loss_1826_avge_mass "1826.6656" xref: spec_1_neutral_loss_1826_flag "false" xref: spec_1_neutral_loss_1826_composition "Hex(5) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1826_mono_mass "1825.660981" xref: spec_2_neutral_loss_1826_avge_mass "1826.6656" xref: spec_2_neutral_loss_1826_flag "false" xref: spec_2_neutral_loss_1826_composition "Hex(5) HexNAc(5)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1781 name: dHex(1)Hex(3)HexNAc(6) def: "DHex Hex(3) HexNAc(6)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1781] xref: record_id "1781" xref: delta_mono_mass "1850.692615" xref: delta_avge_mass "1851.7181" xref: delta_composition "dHex(1) Hex(3) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1851_mono_mass "1850.692615" xref: spec_1_neutral_loss_1851_avge_mass "1851.7181" xref: spec_1_neutral_loss_1851_flag "false" xref: spec_1_neutral_loss_1851_composition "dHex(1) Hex(3) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1851_mono_mass "1850.692615" xref: spec_1_neutral_loss_1851_avge_mass "1851.7181" xref: spec_1_neutral_loss_1851_flag "false" xref: spec_1_neutral_loss_1851_composition "dHex(1) Hex(3) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1851_mono_mass "1850.692615" xref: spec_2_neutral_loss_1851_avge_mass "1851.7181" xref: spec_2_neutral_loss_1851_flag "false" xref: spec_2_neutral_loss_1851_composition "dHex(1) Hex(3) HexNAc(6)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1782 name: dHex(1)Hex(4)HexNAc(4)NeuAc(1) def: "DHex Hex(4) HexNAc(4) NeuAc ---OR--- Hex(3) HexNAc(5) dHex Kdn." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1782] xref: record_id "1782" xref: delta_mono_mass "1897.68211" xref: delta_avge_mass "1898.7283" xref: delta_composition "dHex Hex(4) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2017-11-22 11:17:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1898_mono_mass "1897.68211" xref: spec_1_neutral_loss_1898_avge_mass "1898.7283" xref: spec_1_neutral_loss_1898_flag "false" xref: spec_1_neutral_loss_1898_composition "dHex Hex(4) HexNAc(4) NeuAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1898_mono_mass "1897.68211" xref: spec_1_neutral_loss_1898_avge_mass "1898.7283" xref: spec_1_neutral_loss_1898_flag "false" xref: spec_1_neutral_loss_1898_composition "dHex Hex(4) HexNAc(4) NeuAc" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_1898_mono_mass "1897.68211" xref: spec_2_neutral_loss_1898_avge_mass "1898.7283" xref: spec_2_neutral_loss_1898_flag "false" xref: spec_2_neutral_loss_1898_composition "dHex Hex(4) HexNAc(4) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1783 name: dHex(3)Hex(4)HexNAc(4) def: "DHex(3) Hex(4) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=4&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1783] xref: record_id "1783" xref: delta_mono_mass "1898.702511" xref: delta_avge_mass "1899.7561" xref: delta_composition "dHex(3) Hex(4) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1899_mono_mass "1898.702511" xref: spec_1_neutral_loss_1899_avge_mass "1899.7561" xref: spec_1_neutral_loss_1899_flag "false" xref: spec_1_neutral_loss_1899_composition "dHex(3) Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1899_mono_mass "1898.702511" xref: spec_1_neutral_loss_1899_avge_mass "1899.7561" xref: spec_1_neutral_loss_1899_flag "false" xref: spec_1_neutral_loss_1899_composition "dHex(3) Hex(4) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1899_mono_mass "1898.702511" xref: spec_2_neutral_loss_1899_avge_mass "1899.7561" xref: spec_2_neutral_loss_1899_flag "false" xref: spec_2_neutral_loss_1899_composition "dHex(3) Hex(4) HexNAc(4)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1784 name: dHex(1)Hex(3)HexNAc(5)NeuAc(1) def: "DHex Hex(3) HexNAc(5) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=3&hexnac=5&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1784] xref: record_id "1784" xref: delta_mono_mass "1938.708659" xref: delta_avge_mass "1939.7802" xref: delta_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1939_mono_mass "1938.708659" xref: spec_1_neutral_loss_1939_avge_mass "1939.7802" xref: spec_1_neutral_loss_1939_flag "false" xref: spec_1_neutral_loss_1939_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1939_mono_mass "1938.708659" xref: spec_1_neutral_loss_1939_avge_mass "1939.7802" xref: spec_1_neutral_loss_1939_flag "false" xref: spec_1_neutral_loss_1939_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1939_mono_mass "1938.708659" xref: spec_2_neutral_loss_1939_avge_mass "1939.7802" xref: spec_2_neutral_loss_1939_flag "false" xref: spec_2_neutral_loss_1939_composition "dHex(1) Hex(3) HexNAc(5) NeuAc(1)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1785 name: dHex(2)Hex(4)HexNAc(5) def: "DHex(2) Hex(4) HexNAc(5)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=4&hexnac=5&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1785] xref: record_id "1785" xref: delta_mono_mass "1955.723975" xref: delta_avge_mass "1956.8074" xref: delta_composition "dHex(2) Hex(4) HexNAc(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 12:00:00" xref: date_time_modified "2015-05-05 12:00:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1956_mono_mass "1955.723975" xref: spec_1_neutral_loss_1956_avge_mass "1956.8074" xref: spec_1_neutral_loss_1956_flag "false" xref: spec_1_neutral_loss_1956_composition "dHex(2) Hex(4) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1956_mono_mass "1955.723975" xref: spec_1_neutral_loss_1956_avge_mass "1956.8074" xref: spec_1_neutral_loss_1956_flag "false" xref: spec_1_neutral_loss_1956_composition "dHex(2) Hex(4) HexNAc(5)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_1956_mono_mass "1955.723975" xref: spec_2_neutral_loss_1956_avge_mass "1956.8074" xref: spec_2_neutral_loss_1956_flag "false" xref: spec_2_neutral_loss_1956_composition "dHex(2) Hex(4) HexNAc(5)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1786 name: Hex(1)HexNAc(1)NeuAc(1)Ac(1) def: "Ac Hex HexNAc NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=1&hex=1&hexnac=1&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1786] xref: record_id "1786" xref: delta_mono_mass "698.238177" xref: delta_avge_mass "698.6244" xref: delta_composition "Ac Hex HexNAc NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2015-05-05 16:37:35" xref: date_time_modified "2015-05-06 09:37:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_699_mono_mass "698.238177" xref: spec_1_neutral_loss_699_avge_mass "698.6244" xref: spec_1_neutral_loss_699_flag "false" xref: spec_1_neutral_loss_699_composition "Ac Hex HexNAc NeuAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_699_mono_mass "698.238177" xref: spec_1_neutral_loss_699_avge_mass "698.6244" xref: spec_1_neutral_loss_699_flag "false" xref: spec_1_neutral_loss_699_composition "Ac Hex HexNAc NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1787 name: Label:13C(2)15N(2) def: "13C(2) 15N(2)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1787] comment: For SILAC experiments. synonym: "K4" [] xref: record_id "1787" xref: delta_mono_mass "4.00078" xref: delta_avge_mass "3.9721" xref: delta_composition "C(-2) 13C(2) N(-2) 15N(2)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2015-05-15 22:30:48" xref: date_time_modified "2015-05-24 18:09:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1789 name: Xlink:DSS[155] def: "Ammonium-quenched monolink of DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1789] xref: record_id "1789" xref: delta_mono_mass "155.094629" xref: delta_avge_mass "155.1943" xref: delta_composition "H(13) C(8) N O(2)" xref: username_of_poster "johant" xref: group_of_poster "" xref: date_time_posted "2015-06-17 14:35:50" xref: date_time_modified "2017-08-17 15:09:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1799 name: NQIGG def: "SUMOylation by Giardia lamblia." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1799] xref: record_id "1799" xref: delta_mono_mass "469.228496" xref: delta_avge_mass "469.4921" xref: delta_composition "H(31) C(19) N(7) O(7)" xref: username_of_poster "brunog" xref: group_of_poster "" xref: date_time_posted "2015-10-02 16:16:32" xref: date_time_modified "2015-11-01 16:20:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1800 name: Carboxyethylpyrrole def: "Carboxyethylpyrrole." [PMID:12923198, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1800] xref: record_id "1800" xref: delta_mono_mass "122.036779" xref: delta_avge_mass "122.1213" xref: delta_composition "H(6) C(7) O(2)" xref: username_of_poster "jsc17" xref: group_of_poster "" xref: date_time_posted "2015-11-19 01:35:22" xref: date_time_modified "2016-04-06 08:03:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1801 name: Fluorescein-tyramine def: "Fluorescein-tyramine adduct by peroxidase activity." [URL:http\://www.biosyn.com/tew/tyramide-signal-amplification.aspx, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1801] xref: record_id "1801" xref: delta_mono_mass "493.116152" xref: delta_avge_mass "493.4637" xref: delta_composition "H(19) C(29) N O(7)" xref: username_of_poster "Hideaki" xref: group_of_poster "" xref: date_time_posted "2016-02-02 11:23:24" xref: date_time_modified "2016-04-06 08:08:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1824 name: GEE def: "Transamidation of glycine ethyl ester to glutamine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1824] xref: record_id "1824" xref: delta_mono_mass "86.036779" xref: delta_avge_mass "86.0892" xref: delta_composition "H(6) C(4) O(2)" xref: username_of_poster "michaelmerchant" xref: group_of_poster "" xref: date_time_posted "2016-05-12 15:56:17" xref: date_time_modified "2016-05-18 17:11:04" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "GEE (glycine ethyl ester) is a substrate for the enzyme Factor XIII for cross-linking to fibrinogen" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1825 name: RNPXL def: "Simulate peptide-RNA conjugates." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1825] xref: record_id "1825" xref: delta_mono_mass "324.035867" xref: delta_avge_mass "324.1813" xref: delta_composition "H(13) C(9) N(2) O(9) P" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-06-05 14:23:58" xref: date_time_modified "2016-07-01 11:23:46" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" xref: spec_1_neutral_loss_325_mono_mass "324.035867" xref: spec_1_neutral_loss_325_avge_mass "324.1813" xref: spec_1_neutral_loss_325_flag "false" xref: spec_1_neutral_loss_325_composition "H(13) C(9) N(2) O(9) P" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "R" xref: spec_2_position "Any N-term" xref: spec_2_classification "Other" xref: spec_2_neutral_loss_325_mono_mass "324.035867" xref: spec_2_neutral_loss_325_avge_mass "324.1813" xref: spec_2_neutral_loss_325_flag "false" xref: spec_2_neutral_loss_325_composition "H(13) C(9) N(2) O(9) P" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1826 name: Glu->pyro-Glu+Methyl def: "Pyro-Glu from E + Methylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1826] xref: record_id "1826" xref: delta_mono_mass "-3.994915" xref: delta_avge_mass "-3.9887" xref: delta_composition "C O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-06-15 10:07:50" xref: date_time_modified "2016-06-15 10:07:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1827 name: Glu->pyro-Glu+Methyl:2H(2)13C(1) def: "Pyro-Glu from E + Methylation Medium." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1827] xref: record_id "1827" xref: delta_mono_mass "-0.979006" xref: delta_avge_mass "-0.9837" xref: delta_composition "H(-2) 2H(2) 13C O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-06-15 10:30:37" xref: date_time_modified "2016-06-15 10:30:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Any N-term" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1828 name: LRGG+methyl def: "LeumethylArgGlyGly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1828] comment: LRGG remnant of ubiquitin remaining attached to lysine with missed cleavage due to methylation of arginine. synonym: "LRGG ubiquitin remnant with methylated Arg" [] xref: record_id "1828" xref: delta_mono_mass "397.243753" xref: delta_avge_mass "397.4725" xref: delta_composition "H(31) C(17) N(7) O(4)" xref: username_of_poster "bkatja" xref: group_of_poster "" xref: date_time_posted "2016-07-27 14:34:54" xref: date_time_modified "2016-09-23 13:43:32" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1829 name: LRGG+dimethyl def: "LeudimethylArgGlyGly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1829] comment: LRGG remnant of ubiquitin remaining attached to lysine with missed cleavage due to dimethylation of arginine. synonym: "LRGG ubiquitin remnant with dimethylated Arg" [] xref: record_id "1829" xref: delta_mono_mass "411.259403" xref: delta_avge_mass "411.4991" xref: delta_composition "H(33) C(18) N(7) O(4)" xref: username_of_poster "bkatja" xref: group_of_poster "" xref: date_time_posted "2016-07-27 16:20:40" xref: date_time_modified "2016-09-23 13:43:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1830 name: Biotin-tyramide def: "Biotin-Phenol." [URL:http\://www.iris-biotech.de/ls-3500, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1830] xref: record_id "1830" xref: delta_mono_mass "361.146012" xref: delta_avge_mass "361.4585" xref: delta_composition "H(23) C(18) N(3) O(3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-04 08:05:43" xref: date_time_modified "2016-08-04 08:05:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1831 name: Tris def: "Tris adduct causes 104 Da addition at asparagine-succinimide intermediate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1831] synonym: "tris adduct at asparagine tris adduct at IgG causes 104 Da addition" [] xref: record_id "1831" xref: delta_mono_mass "104.071154" xref: delta_avge_mass "104.1277" xref: delta_composition "H(10) C(4) N O(2)" xref: username_of_poster "pradeepnpraveen" xref: group_of_poster "" xref: date_time_posted "2016-08-04 12:54:25" xref: date_time_modified "2016-09-23 13:48:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_misc_notes "NG sequence specifically after deamidation - Deamidated Asparagine with adjacent glycine are prone for this modification." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1832 name: IASD def: "Iodoacetamide derivative of stilbene (reaction product with thiol)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1832] synonym: "4-acetamido-4'-((iodoacetyl)amino)stilbene-2,2'-disulfonic acid" [] xref: record_id "1832" xref: delta_mono_mass "452.034807" xref: delta_avge_mass "452.4582" xref: delta_composition "H(16) C(18) N(2) O(8) S(2)" xref: username_of_poster "AberdeenProteomics" xref: group_of_poster "" xref: date_time_posted "2016-08-05 12:04:02" xref: date_time_modified "2016-09-23 13:49:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1833 name: NP40 def: "NP-40 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1833] xref: record_id "1833" xref: delta_mono_mass "220.182715" xref: delta_avge_mass "220.3505" xref: delta_composition "H(24) C(15) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-22 14:48:48" xref: date_time_modified "2016-08-22 16:07:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1834 name: Tween20 def: "Tween 20 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1834] xref: record_id "1834" xref: delta_mono_mass "165.164326" xref: delta_avge_mass "165.2951" xref: delta_composition "H(21) C(12)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-22 14:51:41" xref: date_time_modified "2016-08-22 16:07:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1835 name: Tween80 def: "Tween 80 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1835] xref: record_id "1835" xref: delta_mono_mass "263.237491" xref: delta_avge_mass "263.4381" xref: delta_composition "H(31) C(18) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-22 14:52:52" xref: date_time_modified "2016-08-22 16:08:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1836 name: Triton def: "Triton synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1836] xref: record_id "1836" xref: delta_mono_mass "188.156501" xref: delta_avge_mass "188.3086" xref: delta_composition "H(20) C(14)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-22 14:53:44" xref: date_time_modified "2016-08-22 16:07:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Other" xref: spec_1_misc_notes "Triton X-100" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Other" xref: spec_2_misc_notes "Triton X-114" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1837 name: Brij35 def: "Brij 35 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1837] xref: record_id "1837" xref: delta_mono_mass "168.187801" xref: delta_avge_mass "168.319" xref: delta_composition "H(24) C(12)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-22 14:55:48" xref: date_time_modified "2016-08-22 16:07:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1838 name: Brij58 def: "Brij 58 synthetic polymer terminus." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1838] xref: record_id "1838" xref: delta_mono_mass "224.250401" xref: delta_avge_mass "224.4253" xref: delta_composition "H(32) C(16)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-08-22 14:56:22" xref: date_time_modified "2016-08-22 16:08:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Other" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1839 name: betaFNA def: "Beta-Funaltrexamine." [PMID:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3523197/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1839] comment: Covalently bound structure in Manglik et al., Fig. 1b-Fig1c. Chemical formula % Sigma catalog entry. xref: record_id "1839" xref: delta_mono_mass "454.210387" xref: delta_avge_mass "454.5155" xref: delta_composition "H(30) C(25) N(2) O(6)" xref: username_of_poster "shartson" xref: group_of_poster "" xref: date_time_posted "2016-08-26 19:59:17" xref: date_time_modified "2017-01-31 10:02:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1840 name: dHex(1)Hex(7)HexNAc(4) def: "Fucosylated biantennary + 2 alphaGal." [PMID:http://www.ncbi.nlm.nih.gov/pubmed/23924801, URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=7&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1840] xref: record_id "1840" xref: delta_mono_mass "2092.745164" xref: delta_avge_mass "2093.8955" xref: delta_composition "dHex Hex(7) HexNAc(4)" xref: username_of_poster "suckau" xref: group_of_poster "" xref: date_time_posted "2016-09-05 15:52:53" xref: date_time_modified "2016-09-09 16:57:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_misc_notes "observed in monoclonal antibodies" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1841 name: Biotin:Thermo-21328 def: "EZ-Link Sulfo-NHS-SS-Biotin." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011183_EZ_SulfoNHS_SS_Biotin_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1841] synonym: "also Biotin:Thermo-21331" [] xref: record_id "1841" xref: delta_mono_mass "389.090154" xref: delta_avge_mass "389.5564" xref: delta_composition "H(23) C(15) N(3) O(3) S(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2016-11-11 10:34:53" xref: date_time_modified "2016-11-11 10:36:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1843 name: PhosphoCytidine def: "Cytidine monophosphate." [URL:dx.doi.org/10.1038/nchembio0609-378, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1843] comment: By analogy with AMP. synonym: "CMP" [] xref: record_id "1843" xref: delta_mono_mass "305.041287" xref: delta_avge_mass "305.1812" xref: delta_composition "H(12) C(9) N(3) O(7) P" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-02-01 17:36:16" xref: date_time_modified "2017-02-02 10:16:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "Post-translational" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1845 name: AzidoF def: "Azidophenylalanine." [PMID:26597962, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1845] xref: record_id "1845" xref: delta_mono_mass "41.001397" xref: delta_avge_mass "41.0122" xref: delta_composition "H(-1) N(3)" xref: username_of_poster "astridb" xref: group_of_poster "" xref: date_time_posted "2017-02-17 09:53:27" xref: date_time_modified "2017-03-03 15:46:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "F" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1846 name: Dimethylaminoethyl def: "Cys alkylation by dimethylaminoethyl halide." [PMID:20373501, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1846] xref: record_id "1846" xref: delta_mono_mass "71.073499" xref: delta_avge_mass "71.121" xref: delta_composition "H(9) C(4) N" xref: username_of_poster "Kramerh" xref: group_of_poster "" xref: date_time_posted "2017-02-17 16:10:59" xref: date_time_modified "2017-03-03 15:50:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1848 name: Gluratylation def: "Glutarylation." [PMID:24703693, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1848] xref: record_id "1848" xref: delta_mono_mass "114.031694" xref: delta_avge_mass "114.0993" xref: delta_composition "H(6) C(5) O(3)" xref: username_of_poster "cfeller" xref: group_of_poster "" xref: date_time_posted "2017-03-30 11:15:26" xref: date_time_modified "2017-04-05 12:31:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1849 name: hydroxyisobutyryl def: "2-hydroxyisobutyrylation." [PMID:24681537, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1849] synonym: "2-hydroxyisobutanoyl 3-hydroxybutanoyl" [] xref: record_id "1849" xref: delta_mono_mass "86.036779" xref: delta_avge_mass "86.0892" xref: delta_composition "H(6) C(4) O(2)" xref: username_of_poster "cfeller" xref: group_of_poster "" xref: date_time_posted "2017-03-30 11:16:14" xref: date_time_modified "2021-03-11 11:57:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1868 name: MeMePhosphorothioate def: "S-Methyl Methyl phosphorothioate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1868] xref: record_id "1868" xref: delta_mono_mass "107.979873" xref: delta_avge_mass "108.0993" xref: delta_composition "H(5) C(2) O P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2017-04-11 18:32:43" xref: date_time_modified "2017-06-02 16:01:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1870 name: Cation:Fe[III] def: "Replacement of 3 protons by iron." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1870] xref: record_id "1870" xref: delta_mono_mass "52.911464" xref: delta_avge_mass "52.8212" xref: delta_composition "H(-3) Fe" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-06-15 12:58:58" xref: date_time_modified "2017-06-15 12:58:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1871 name: DTT def: "DTT adduct of cysteine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1871] xref: record_id "1871" xref: delta_mono_mass "151.996571" xref: delta_avge_mass "152.2351" xref: delta_composition "H(8) C(4) O(2) S(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-06-15 14:09:46" xref: date_time_modified "2017-06-15 14:12:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1872 name: DYn-2 def: "Sulfenic Acid specific probe." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1872] xref: record_id "1872" xref: delta_mono_mass "161.09664" xref: delta_avge_mass "161.2203" xref: delta_composition "H(13) C(11) O" xref: username_of_poster "SamanthaLapehn" xref: group_of_poster "" xref: date_time_posted "2017-07-06 17:23:58" xref: date_time_modified "2017-08-05 02:16:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Other" xref: spec_1_misc_notes "-SOH" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1873 name: MesitylOxide def: "Acetone chemical artifact." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1873] xref: record_id "1873" xref: delta_mono_mass "98.073165" xref: delta_avge_mass "98.143" xref: delta_composition "H(10) C(6) O" xref: username_of_poster "mlefers" xref: group_of_poster "" xref: date_time_posted "2017-07-13 19:50:51" xref: date_time_modified "2017-08-04 17:22:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1875 name: methylol def: "Formaldehyde induced modifications." [PMID:https://www.ncbi.nlm.nih.gov/pubmed/16704222, PMID:https://www.ncbi.nlm.nih.gov/pubmed/14638685, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1875] xref: record_id "1875" xref: delta_mono_mass "30.010565" xref: delta_avge_mass "30.026" xref: delta_composition "H(2) C O" xref: username_of_poster "robertyen" xref: group_of_poster "" xref: date_time_posted "2017-07-14 18:43:02" xref: date_time_modified "2017-08-04 17:27:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "W" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1877 name: Xlink:DSS[259] def: "Tris-quenched monolink of DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1877] xref: record_id "1877" xref: delta_mono_mass "259.141973" xref: delta_avge_mass "259.2988" xref: delta_composition "H(21) C(12) N O(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 14:29:30" xref: date_time_modified "2017-08-17 15:09:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1878 name: Xlink:DSSO[176] def: "Water-quenched monolink of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1878] xref: record_id "1878" xref: delta_mono_mass "176.01433" xref: delta_avge_mass "176.1903" xref: delta_composition "H(8) C(6) O(4) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 16:26:01" xref: date_time_modified "2017-08-17 16:26:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1879 name: Xlink:DSSO[175] def: "Ammonia-quenched monolink of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1879] xref: record_id "1879" xref: delta_mono_mass "175.030314" xref: delta_avge_mass "175.2056" xref: delta_composition "H(9) C(6) N O(3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 16:27:45" xref: date_time_modified "2017-08-17 16:27:45" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1880 name: Xlink:DSSO[279] def: "Tris-quenched monolink of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1880] xref: record_id "1880" xref: delta_mono_mass "279.077658" xref: delta_avge_mass "279.3101" xref: delta_composition "H(17) C(10) N O(6) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 16:29:08" xref: date_time_modified "2017-08-17 16:29:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1881 name: Xlink:DSSO[54] def: "Alkene fragment of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1881] xref: record_id "1881" xref: delta_mono_mass "54.010565" xref: delta_avge_mass "54.0474" xref: delta_composition "H(2) C(3) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 16:31:03" xref: date_time_modified "2017-08-17 16:31:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1882 name: Xlink:DSSO[86] def: "Thiol fragment of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1882] xref: record_id "1882" xref: delta_mono_mass "85.982635" xref: delta_avge_mass "86.1124" xref: delta_composition "H(2) C(3) O S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 16:32:17" xref: date_time_modified "2017-08-17 16:32:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1883 name: Xlink:DSSO[104] def: "Sulfenic acid fragment of DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1883] xref: record_id "1883" xref: delta_mono_mass "103.9932" xref: delta_avge_mass "104.1277" xref: delta_composition "H(4) C(3) O(2) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-17 16:33:16" xref: date_time_modified "2017-08-17 16:33:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1885 name: Xlink:BuUrBu[111] def: "BuUr fragment of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1885] xref: record_id "1885" xref: delta_mono_mass "111.032028" xref: delta_avge_mass "111.0987" xref: delta_composition "H(5) C(5) N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-18 09:34:59" xref: date_time_modified "2017-09-01 14:44:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1886 name: Xlink:BuUrBu[85] def: "Bu fragment of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1886] xref: record_id "1886" xref: delta_mono_mass "85.052764" xref: delta_avge_mass "85.1045" xref: delta_composition "H(7) C(4) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-18 09:36:27" xref: date_time_modified "2017-09-01 14:44:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1887 name: Xlink:BuUrBu[213] def: "Ammonia quenched monolink of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1887] xref: record_id "1887" xref: delta_mono_mass "213.111341" xref: delta_avge_mass "213.2337" xref: delta_composition "H(15) C(9) N(3) O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-18 09:38:52" xref: date_time_modified "2017-09-01 14:46:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1888 name: Xlink:BuUrBu[214] def: "Water quenched monolink of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1888] xref: record_id "1888" xref: delta_mono_mass "214.095357" xref: delta_avge_mass "214.2185" xref: delta_composition "H(14) C(9) N(2) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-18 09:43:05" xref: date_time_modified "2017-09-01 14:46:10" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1889 name: Xlink:BuUrBu[317] def: "Tris quenched monolink of BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1889] xref: record_id "1889" xref: delta_mono_mass "317.158686" xref: delta_avge_mass "317.3382" xref: delta_composition "H(23) C(13) N(3) O(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-18 09:44:40" xref: date_time_modified "2017-09-01 14:46:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1896 name: Xlink:DSSO[158] def: "Intact DSSO crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A33545, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1896] xref: record_id "1896" xref: delta_mono_mass "158.003765" xref: delta_avge_mass "158.175" xref: delta_composition "H(6) C(6) O(3) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 14:53:02" xref: date_time_modified "2017-08-31 14:53:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1897 name: Xlink:EGS[226] def: "Intact EGS cross-linker." [PMID:36892, URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011281_EGS_SulfoEGS_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1897] synonym: "Ethylene glycolbis(succinimidylsuccinate)" [] xref: record_id "1897" xref: delta_mono_mass "226.047738" xref: delta_avge_mass "226.1828" xref: delta_composition "H(10) C(10) O(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 14:54:57" xref: date_time_modified "2017-08-31 14:54:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1898 name: Xlink:DSS[138] def: "Intact DSS/BS3 crosslinker." [PMID:8326953, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1898] xref: record_id "1898" xref: delta_mono_mass "138.06808" xref: delta_avge_mass "138.1638" xref: delta_composition "H(10) C(8) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 14:55:56" xref: date_time_modified "2017-08-31 14:55:56" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1899 name: Xlink:BuUrBu[196] def: "Intact BuUrBu crosslinker." [URL:https\://www.thermofisher.com/order/catalog/product/A35459, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1899] xref: record_id "1899" xref: delta_mono_mass "196.084792" xref: delta_avge_mass "196.2032" xref: delta_composition "H(12) C(9) N(2) O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 14:57:02" xref: date_time_modified "2017-09-01 14:45:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1900 name: Xlink:DTBP[172] def: "Intact DTBP crosslinker." [PMID:770170, URL:http\://tools.thermofisher.com/content/sfs/manuals/MAN0011314_ImidoesterCrsLnk_DMA_DMP_DMS_DTBP_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1900] comment: Imidoester cross-linker. synonym: "dimethyl 3,3'-dithiobispropionimidate" [] xref: record_id "1900" xref: delta_mono_mass "172.01289" xref: delta_avge_mass "172.2711" xref: delta_composition "H(8) C(6) N(2) S(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 14:59:08" xref: date_time_modified "2017-08-31 14:59:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1901 name: Xlink:DST[114] def: "Intact DST crosslinker." [PMID:212103, URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011282_DST_UG.pdf, PMID:3001048, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1901] xref: record_id "1901" xref: delta_mono_mass "113.995309" xref: delta_avge_mass "114.0563" xref: delta_composition "H(2) C(4) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 15:00:13" xref: date_time_modified "2017-08-31 15:00:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1902 name: Xlink:DTSSP[174] def: "Intact DSP/DTSSP crosslinker." [URL:https\://tools.thermofisher.com/content/sfs/manuals/MAN0011280_DTSSP_DSP_UG.pdf, PMID:1262347, PMID:8457554, PMID:322714, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1902] synonym: "Also known as DSP" [] xref: record_id "1902" xref: delta_mono_mass "173.980921" xref: delta_avge_mass "174.2406" xref: delta_composition "H(6) C(6) O(2) S(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 15:01:08" xref: date_time_modified "2017-08-31 15:01:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1903 name: Xlink:SMCC[219] def: "Intact SMCC cross-link." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011295_SMCC_SulfoSMCC_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1903] xref: record_id "1903" xref: delta_mono_mass "219.089543" xref: delta_avge_mass "219.2365" xref: delta_composition "H(13) C(12) N O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-08-31 15:02:14" xref: date_time_modified "2017-09-05 15:00:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1905 name: Xlink:BS2G[96] def: "Intact BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1905] xref: record_id "1905" xref: delta_mono_mass "96.021129" xref: delta_avge_mass "96.0841" xref: delta_composition "H(4) C(5) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-05 16:22:19" xref: date_time_modified "2017-09-05 16:22:37" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1906 name: Xlink:BS2G[113] def: "Ammonium-quenched monolink of BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1906] xref: record_id "1906" xref: delta_mono_mass "113.047679" xref: delta_avge_mass "113.1146" xref: delta_composition "H(7) C(5) N O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-05 16:26:19" xref: date_time_modified "2017-09-05 16:26:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1907 name: Xlink:BS2G[114] def: "Water-quenched monolink of BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1907] xref: record_id "1907" xref: delta_mono_mass "114.031694" xref: delta_avge_mass "114.0993" xref: delta_composition "H(6) C(5) O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-05 16:27:03" xref: date_time_modified "2017-09-05 16:27:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1908 name: Xlink:BS2G[217] def: "Tris-quenched monolink of BS2-G crosslinker." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011542_BS3_d0d4_BS2G_d0d3_UG.pdf, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1908] xref: record_id "1908" xref: delta_mono_mass "217.095023" xref: delta_avge_mass "217.2191" xref: delta_composition "H(15) C(9) N O(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-05 16:28:28" xref: date_time_modified "2017-09-05 16:28:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1910 name: Cation:Al[III] def: "Replacement of 3 protons by aluminium." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1910] xref: record_id "1910" xref: delta_mono_mass "23.958063" xref: delta_avge_mass "23.9577" xref: delta_composition "H(-3) Al" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-05 17:13:59" xref: date_time_modified "2017-09-05 17:13:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1911 name: Xlink:DMP[139] def: "Ammonia quenched monolink of DMP crosslinker." [PMID:2144419, PMID:14696200, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1911] synonym: "Dimethyl pimelimidate dead-end crosslink" [] xref: record_id "1911" xref: delta_mono_mass "139.110947" xref: delta_avge_mass "139.1982" xref: delta_composition "H(13) C(7) N(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-06 10:03:30" xref: date_time_modified "2017-09-06 10:03:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1912 name: Xlink:DMP[122] def: "Intact DMP crosslinker." [PMID:2144419, PMID:14696200, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1912] synonym: "Dimethyl pimelimidate" [] xref: record_id "1912" xref: delta_mono_mass "122.084398" xref: delta_avge_mass "122.1677" xref: delta_composition "H(10) C(7) N(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-09-06 10:04:39" xref: date_time_modified "2017-09-06 10:04:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1913 name: glyoxalAGE def: "Glyoxal-derived AGE." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1913] xref: record_id "1913" xref: delta_mono_mass "21.98435" xref: delta_avge_mass "22.0055" xref: delta_composition "H(-2) C(2)" xref: username_of_poster "mlefers" xref: group_of_poster "" xref: date_time_posted "2017-10-05 13:54:48" xref: date_time_modified "2017-11-08 17:25:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1914 name: Met->AspSA def: "Methionine oxidation to aspartic semialdehyde." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1914] xref: record_id "1914" xref: delta_mono_mass "-32.008456" xref: delta_avge_mass "-32.1081" xref: delta_composition "H(-4) C(-1) O S(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-10-06 15:35:18" xref: date_time_modified "2017-10-06 15:37:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "M" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1915 name: Decarboxylation def: "Decarboxylation." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1915] xref: record_id "1915" xref: delta_mono_mass "-30.010565" xref: delta_avge_mass "-30.026" xref: delta_composition "H(-2) C(-1) O(-1)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-10-06 15:40:31" xref: date_time_modified "2017-10-06 15:40:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1916 name: Aspartylurea def: "Aspartylurea." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1916] xref: record_id "1916" xref: delta_mono_mass "-10.031969" xref: delta_avge_mass "-10.0412" xref: delta_composition "H(-2) C(-1) N(-2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-10-06 15:43:52" xref: date_time_modified "2017-10-06 15:43:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1917 name: Formylasparagine def: "In Bachi as Formylaspargine (typo?)." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1917] xref: record_id "1917" xref: delta_mono_mass "4.97893" xref: delta_avge_mass "4.9735" xref: delta_composition "H(-1) C(-1) N(-1) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-10-06 16:01:29" xref: date_time_modified "2017-11-02 17:23:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1918 name: Carbonyl def: "Aldehyde and ketone modifications." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1918] xref: record_id "1918" xref: delta_mono_mass "13.979265" xref: delta_avge_mass "13.9835" xref: delta_composition "H(-2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-10-06 16:09:53" xref: date_time_modified "2017-10-06 16:12:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "A" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "E" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "I" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "L" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "Q" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "R" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" xref: spec_7_group "7" xref: spec_7_hidden "1" xref: spec_7_site "S" xref: spec_7_position "Anywhere" xref: spec_7_classification "Chemical derivative" xref: spec_8_group "8" xref: spec_8_hidden "1" xref: spec_8_site "V" xref: spec_8_position "Anywhere" xref: spec_8_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1920 name: AFB1_Dialdehyde def: "Adduction of aflatoxin B1 Dialdehyde to lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1920] xref: record_id "1920" xref: delta_mono_mass "310.047738" xref: delta_avge_mass "310.2577" xref: delta_composition "H(10) C(17) O(6)" xref: username_of_poster "shenmic" xref: group_of_poster "" xref: date_time_posted "2017-10-17 14:58:16" xref: date_time_modified "2017-11-02 17:07:54" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1922 name: Pro->HAVA def: "Proline oxidation to 5-hydroxy-2-aminovaleric acid." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1922] xref: record_id "1922" xref: delta_mono_mass "18.010565" xref: delta_avge_mass "18.0153" xref: delta_composition "H(2) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-03 09:13:16" xref: date_time_modified "2017-11-03 09:13:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "P" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1923 name: Delta:H(-4)O(2) def: "Tryptophan oxidation to beta-unsaturated-2,4-bis-tryptophandione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1923] xref: record_id "1923" xref: delta_mono_mass "27.958529" xref: delta_avge_mass "27.967" xref: delta_composition "H(-4) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-03 09:17:12" xref: date_time_modified "2017-11-08 17:00:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1924 name: Delta:H(-4)O(3) def: "Tryptophan oxidation to hydroxy-bis-tryptophandione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1924] xref: record_id "1924" xref: delta_mono_mass "43.953444" xref: delta_avge_mass "43.9664" xref: delta_composition "H(-4) O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-08 16:11:21" xref: date_time_modified "2017-11-08 17:01:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1925 name: Delta:O(4) def: "Tryptophan oxidation to dihydroxy-N-formaylkynurenine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1925] xref: record_id "1925" xref: delta_mono_mass "63.979659" xref: delta_avge_mass "63.9976" xref: delta_composition "O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-08 16:33:11" xref: date_time_modified "2017-11-08 17:01:29" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "W" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1926 name: Delta:H(3)C(3)O(2) def: "Methylglyoxal-derived carboxyethyllysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1926] xref: record_id "1926" xref: delta_mono_mass "71.013304" xref: delta_avge_mass "71.0547" xref: delta_composition "H(3) C(3) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-08 16:41:02" xref: date_time_modified "2017-11-08 17:02:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1927 name: Delta:H(4)C(5)O(1) def: "Methylglyoxal-derived argpyrimidine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1927] xref: record_id "1927" xref: delta_mono_mass "80.026215" xref: delta_avge_mass "80.0847" xref: delta_composition "H(4) C(5) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-08 16:43:41" xref: date_time_modified "2018-06-26 10:38:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1928 name: Delta:H(10)C(8)O(1) def: "Crotonaldehyde-derived dimethyl-FDP-lysine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1928] xref: record_id "1928" xref: delta_mono_mass "122.073165" xref: delta_avge_mass "122.1644" xref: delta_composition "H(10) C(8) O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-08 17:04:01" xref: date_time_modified "2017-11-08 17:04:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1929 name: Delta:H(6)C(7)O(4) def: "Methylglyoxal-derived tetrahydropyrimidine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1929] xref: record_id "1929" xref: delta_mono_mass "154.026609" xref: delta_avge_mass "154.1201" xref: delta_composition "H(6) C(7) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-08 17:12:02" xref: date_time_modified "2017-11-08 17:12:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "R" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1930 name: Pent(2) def: "Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1930] xref: record_id "1930" xref: delta_mono_mass "264.084518" xref: delta_avge_mass "264.2292" xref: delta_composition "Pent(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 12:05:50" xref: date_time_modified "2017-11-23 13:01:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_265_mono_mass "264.084518" xref: spec_1_neutral_loss_265_avge_mass "264.2292" xref: spec_1_neutral_loss_265_flag "false" xref: spec_1_neutral_loss_265_composition "Pent(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_265_mono_mass "264.084518" xref: spec_1_neutral_loss_265_avge_mass "264.2292" xref: spec_1_neutral_loss_265_flag "false" xref: spec_1_neutral_loss_265_composition "Pent(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1931 name: Pent(1)HexNAc(1) def: "Pent HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1931] xref: record_id "1931" xref: delta_mono_mass "335.121631" xref: delta_avge_mass "335.3071" xref: delta_composition "Pent HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 13:00:37" xref: date_time_modified "2017-11-23 13:05:51" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_336_mono_mass "335.121631" xref: spec_1_neutral_loss_336_avge_mass "335.3071" xref: spec_1_neutral_loss_336_flag "false" xref: spec_1_neutral_loss_336_composition "Pent HexNAc" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_336_mono_mass "335.121631" xref: spec_1_neutral_loss_336_avge_mass "335.3071" xref: spec_1_neutral_loss_336_flag "false" xref: spec_1_neutral_loss_336_composition "Pent HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1932 name: Hex(2)Sulf(1) def: "Hex(2) O(3) S." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1932] xref: record_id "1932" xref: delta_mono_mass "404.062462" xref: delta_avge_mass "404.3444" xref: delta_composition "O(3) S Hex(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 15:39:42" xref: date_time_modified "2017-11-23 15:40:36" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_405_mono_mass "404.062462" xref: spec_1_neutral_loss_405_avge_mass "404.3444" xref: spec_1_neutral_loss_405_flag "false" xref: spec_1_neutral_loss_405_composition "O(3) S Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_405_mono_mass "404.062462" xref: spec_1_neutral_loss_405_avge_mass "404.3444" xref: spec_1_neutral_loss_405_flag "false" xref: spec_1_neutral_loss_405_composition "O(3) S Hex(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1933 name: Hex(1)Pent(2)Me(1) def: "Hex:1 Pent:2 Me:1." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&pent=2&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1933] xref: record_id "1933" xref: delta_mono_mass "440.152991" xref: delta_avge_mass "440.3964" xref: delta_composition "Me Pent(2) Hex" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 15:47:22" xref: date_time_modified "2017-11-23 15:49:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_441_mono_mass "440.152991" xref: spec_1_neutral_loss_441_avge_mass "440.3964" xref: spec_1_neutral_loss_441_flag "false" xref: spec_1_neutral_loss_441_composition "Me Pent(2) Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_441_mono_mass "440.152991" xref: spec_1_neutral_loss_441_avge_mass "440.3964" xref: spec_1_neutral_loss_441_flag "false" xref: spec_1_neutral_loss_441_composition "Me Pent(2) Hex" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1934 name: HexNAc(2)Sulf(1) def: "HexNAc(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1934] xref: record_id "1934" xref: delta_mono_mass "486.11556" xref: delta_avge_mass "486.4482" xref: delta_composition "O(3) S HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 16:35:09" xref: date_time_modified "2017-11-23 16:35:09" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_487_mono_mass "486.11556" xref: spec_1_neutral_loss_487_avge_mass "486.4482" xref: spec_1_neutral_loss_487_flag "false" xref: spec_1_neutral_loss_487_composition "O(3) S HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_487_mono_mass "486.11556" xref: spec_1_neutral_loss_487_avge_mass "486.4482" xref: spec_1_neutral_loss_487_flag "false" xref: spec_1_neutral_loss_487_composition "O(3) S HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1935 name: Hex(1)Pent(3)Me(1) def: "Hex Pent(3) Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&pent=3&hex=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1935] xref: record_id "1935" xref: delta_mono_mass "572.19525" xref: delta_avge_mass "572.511" xref: delta_composition "Me Pent(3) Hex" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 16:40:05" xref: date_time_modified "2017-11-23 16:40:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_573_mono_mass "572.19525" xref: spec_1_neutral_loss_573_avge_mass "572.511" xref: spec_1_neutral_loss_573_flag "false" xref: spec_1_neutral_loss_573_composition "Me Pent(3) Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_573_mono_mass "572.19525" xref: spec_1_neutral_loss_573_avge_mass "572.511" xref: spec_1_neutral_loss_573_flag "false" xref: spec_1_neutral_loss_573_composition "Me Pent(3) Hex" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1936 name: Hex(2)Pent(2) def: "Hex(2) Pent(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=2&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1936] xref: record_id "1936" xref: delta_mono_mass "588.190165" xref: delta_avge_mass "588.5104" xref: delta_composition "Pent(2) Hex(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 17:22:55" xref: date_time_modified "2017-11-23 17:22:55" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_589_mono_mass "588.190165" xref: spec_1_neutral_loss_589_avge_mass "588.5104" xref: spec_1_neutral_loss_589_flag "false" xref: spec_1_neutral_loss_589_composition "Pent(2) Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_589_mono_mass "588.190165" xref: spec_1_neutral_loss_589_avge_mass "588.5104" xref: spec_1_neutral_loss_589_flag "false" xref: spec_1_neutral_loss_589_composition "Pent(2) Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1937 name: Hex(2)Pent(2)Me(1) def: "Hex(2) Pent(2) Me." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&pent=2&hex=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1937] xref: record_id "1937" xref: delta_mono_mass "602.205815" xref: delta_avge_mass "602.537" xref: delta_composition "Me Pent(2) Hex(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 17:24:00" xref: date_time_modified "2017-11-23 17:24:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_603_mono_mass "602.205815" xref: spec_1_neutral_loss_603_avge_mass "602.537" xref: spec_1_neutral_loss_603_flag "false" xref: spec_1_neutral_loss_603_composition "Me Pent(2) Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_603_mono_mass "602.205815" xref: spec_1_neutral_loss_603_avge_mass "602.537" xref: spec_1_neutral_loss_603_flag "false" xref: spec_1_neutral_loss_603_composition "Me Pent(2) Hex(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1938 name: Hex(4)HexA(1) def: "Hex(4) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1938] xref: record_id "1938" xref: delta_mono_mass "824.243382" xref: delta_avge_mass "824.6865" xref: delta_composition "Hex(4) HexA" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 17:49:25" xref: date_time_modified "2017-11-23 17:49:25" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_825_mono_mass "824.243382" xref: spec_1_neutral_loss_825_avge_mass "824.6865" xref: spec_1_neutral_loss_825_flag "false" xref: spec_1_neutral_loss_825_composition "Hex(4) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_825_mono_mass "824.243382" xref: spec_1_neutral_loss_825_avge_mass "824.6865" xref: spec_1_neutral_loss_825_flag "false" xref: spec_1_neutral_loss_825_composition "Hex(4) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1939 name: Hex(2)HexNAc(1)Pent(1)HexA(1) def: "Hex(2) HexNAc Pent HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?pent=1&hex=2&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1939] xref: record_id "1939" xref: delta_mono_mass "835.259366" xref: delta_avge_mass "835.7125" xref: delta_composition "Pent Hex(2) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-23 17:51:41" xref: date_time_modified "2017-11-23 17:51:41" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_836_mono_mass "835.259366" xref: spec_1_neutral_loss_836_avge_mass "835.7125" xref: spec_1_neutral_loss_836_flag "false" xref: spec_1_neutral_loss_836_composition "Pent Hex(2) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_836_mono_mass "835.259366" xref: spec_1_neutral_loss_836_avge_mass "835.7125" xref: spec_1_neutral_loss_836_flag "false" xref: spec_1_neutral_loss_836_composition "Pent Hex(2) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1940 name: Hex(3)HexNAc(1)HexA(1) def: "Hex(3) HexNAc HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1940] xref: record_id "1940" xref: delta_mono_mass "865.269931" xref: delta_avge_mass "865.7384" xref: delta_composition "Hex(3) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 10:41:50" xref: date_time_modified "2017-11-24 10:41:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_866_mono_mass "865.269931" xref: spec_1_neutral_loss_866_avge_mass "865.7384" xref: spec_1_neutral_loss_866_flag "false" xref: spec_1_neutral_loss_866_composition "Hex(3) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_866_mono_mass "865.269931" xref: spec_1_neutral_loss_866_avge_mass "865.7384" xref: spec_1_neutral_loss_866_flag "false" xref: spec_1_neutral_loss_866_composition "Hex(3) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1941 name: Hex(1)HexNAc(2)dHex(2)Sulf(1) def: "Hex HexNAc(2) dHex(2) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=1&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1941] xref: record_id "1941" xref: delta_mono_mass "940.284201" xref: delta_avge_mass "940.8712" xref: delta_composition "O(3) S dHex(2) Hex HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 10:45:35" xref: date_time_modified "2017-11-24 10:45:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_941_mono_mass "940.284201" xref: spec_1_neutral_loss_941_avge_mass "940.8712" xref: spec_1_neutral_loss_941_flag "false" xref: spec_1_neutral_loss_941_composition "O(3) S dHex(2) Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_941_mono_mass "940.284201" xref: spec_1_neutral_loss_941_avge_mass "940.8712" xref: spec_1_neutral_loss_941_flag "false" xref: spec_1_neutral_loss_941_composition "O(3) S dHex(2) Hex HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1942 name: HexA(2)HexNAc(3) def: "HexA(2) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hexa=2&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1942] xref: record_id "1942" xref: delta_mono_mass "961.302294" xref: delta_avge_mass "961.8258" xref: delta_composition "HexA(2) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 10:48:18" xref: date_time_modified "2017-11-24 10:48:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_962_mono_mass "961.302294" xref: spec_1_neutral_loss_962_avge_mass "961.8258" xref: spec_1_neutral_loss_962_flag "false" xref: spec_1_neutral_loss_962_composition "HexA(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_962_mono_mass "961.302294" xref: spec_1_neutral_loss_962_avge_mass "961.8258" xref: spec_1_neutral_loss_962_flag "false" xref: spec_1_neutral_loss_962_composition "HexA(2) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1943 name: dHex(1)Hex(4)HexA(1) def: "DHex Hex(4) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=4&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1943] xref: record_id "1943" xref: delta_mono_mass "970.301291" xref: delta_avge_mass "970.8277" xref: delta_composition "dHex Hex(4) HexA" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 10:51:51" xref: date_time_modified "2017-11-24 10:52:38" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_971_mono_mass "970.301291" xref: spec_1_neutral_loss_971_avge_mass "970.8277" xref: spec_1_neutral_loss_971_flag "false" xref: spec_1_neutral_loss_971_composition "dHex Hex(4) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_971_mono_mass "970.301291" xref: spec_1_neutral_loss_971_avge_mass "970.8277" xref: spec_1_neutral_loss_971_flag "false" xref: spec_1_neutral_loss_971_composition "dHex Hex(4) HexA" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1944 name: Hex(5)HexA(1) def: "Hex(5) HexA." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=5&hexa=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1944] xref: record_id "1944" xref: delta_mono_mass "986.296206" xref: delta_avge_mass "986.8271" xref: delta_composition "Hex(5) HexA" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 10:54:21" xref: date_time_modified "2017-11-24 10:54:21" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_987_mono_mass "986.296206" xref: spec_1_neutral_loss_987_avge_mass "986.8271" xref: spec_1_neutral_loss_987_flag "false" xref: spec_1_neutral_loss_987_composition "Hex(5) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_987_mono_mass "986.296206" xref: spec_1_neutral_loss_987_avge_mass "986.8271" xref: spec_1_neutral_loss_987_flag "false" xref: spec_1_neutral_loss_987_composition "Hex(5) HexA" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1945 name: Hex(4)HexA(1)HexNAc(1) def: "Hex(4) HexA HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexa=1&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1945] xref: record_id "1945" xref: delta_mono_mass "1027.322755" xref: delta_avge_mass "1027.879" xref: delta_composition "Hex(4) HexA HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 11:02:26" xref: date_time_modified "2017-11-24 11:03:00" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1028_mono_mass "1027.322755" xref: spec_1_neutral_loss_1028_avge_mass "1027.879" xref: spec_1_neutral_loss_1028_flag "false" xref: spec_1_neutral_loss_1028_composition "Hex(4) HexA HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1028_mono_mass "1027.322755" xref: spec_1_neutral_loss_1028_avge_mass "1027.879" xref: spec_1_neutral_loss_1028_flag "false" xref: spec_1_neutral_loss_1028_composition "Hex(4) HexA HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1946 name: dHex(3)Hex(3)HexNAc(1) def: "DHex(3) Hex(3) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1946] xref: record_id "1946" xref: delta_mono_mass "1127.41157" xref: delta_avge_mass "1128.0379" xref: delta_composition "dHex(3) Hex(3) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 11:05:19" xref: date_time_modified "2017-11-24 11:05:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1128_mono_mass "1127.41157" xref: spec_1_neutral_loss_1128_avge_mass "1128.0379" xref: spec_1_neutral_loss_1128_flag "false" xref: spec_1_neutral_loss_1128_composition "dHex(3) Hex(3) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1128_mono_mass "1127.41157" xref: spec_1_neutral_loss_1128_avge_mass "1128.0379" xref: spec_1_neutral_loss_1128_flag "false" xref: spec_1_neutral_loss_1128_composition "dHex(3) Hex(3) HexNAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1947 name: Hex(6)HexNAc(1) def: "Hex(6) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1947] xref: record_id "1947" xref: delta_mono_mass "1175.396314" xref: delta_avge_mass "1176.0361" xref: delta_composition "Hex(6) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 11:50:56" xref: date_time_modified "2018-03-28 14:15:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1176_mono_mass "1175.396314" xref: spec_1_neutral_loss_1176_avge_mass "1176.0361" xref: spec_1_neutral_loss_1176_flag "false" xref: spec_1_neutral_loss_1176_composition "Hex(6) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1948 name: Hex(1)HexNAc(4)dHex(1)Sulf(1) def: "Sulf dHex Hex HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=1&hex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1948] xref: record_id "1948" xref: delta_mono_mass "1200.385037" xref: delta_avge_mass "1201.1151" xref: delta_composition "Sulf dHex Hex HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 11:56:31" xref: date_time_modified "2017-11-24 11:57:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1201_mono_mass "1200.385037" xref: spec_1_neutral_loss_1201_avge_mass "1201.1151" xref: spec_1_neutral_loss_1201_flag "false" xref: spec_1_neutral_loss_1201_composition "Sulf dHex Hex HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1201_mono_mass "1200.385037" xref: spec_1_neutral_loss_1201_avge_mass "1201.1151" xref: spec_1_neutral_loss_1201_flag "false" xref: spec_1_neutral_loss_1201_composition "Sulf dHex Hex HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1949 name: dHex(1)Hex(2)HexNAc(1)NeuAc(2) def: "DHex Hex(2) HexNAc NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=2&hexnac=1&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1949] xref: record_id "1949" xref: delta_mono_mass "1255.433762" xref: delta_avge_mass "1256.1241" xref: delta_composition "dHex Hex(2) HexNAc NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 11:58:40" xref: date_time_modified "2017-11-24 13:36:28" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1256_mono_mass "1255.433762" xref: spec_1_neutral_loss_1256_avge_mass "1256.1241" xref: spec_1_neutral_loss_1256_flag "false" xref: spec_1_neutral_loss_1256_composition "dHex Hex(2) HexNAc NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1256_mono_mass "1255.433762" xref: spec_1_neutral_loss_1256_avge_mass "1256.1241" xref: spec_1_neutral_loss_1256_flag "false" xref: spec_1_neutral_loss_1256_composition "dHex Hex(2) HexNAc NeuAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1950 name: dHex(3)Hex(3)HexNAc(2) def: "DHex(3) Hex(3) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=3&hex=3&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1950] xref: record_id "1950" xref: delta_mono_mass "1330.490942" xref: delta_avge_mass "1331.2304" xref: delta_composition "dHex(3) Hex(3) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 12:05:34" xref: date_time_modified "2017-11-24 12:06:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1331_mono_mass "1330.490942" xref: spec_1_neutral_loss_1331_avge_mass "1331.2304" xref: spec_1_neutral_loss_1331_flag "false" xref: spec_1_neutral_loss_1331_composition "dHex(3) Hex(3) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1331_mono_mass "1330.490942" xref: spec_1_neutral_loss_1331_avge_mass "1331.2304" xref: spec_1_neutral_loss_1331_flag "false" xref: spec_1_neutral_loss_1331_composition "dHex(3) Hex(3) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1951 name: dHex(2)Hex(1)HexNAc(4)Sulf(1) def: "DHex(2) Hex HexNAc(4) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=1&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1951] xref: record_id "1951" xref: delta_mono_mass "1346.442946" xref: delta_avge_mass "1347.2563" xref: delta_composition "Sulf dHex(2) Hex HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 12:07:49" xref: date_time_modified "2017-11-24 12:08:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1347_mono_mass "1346.442946" xref: spec_1_neutral_loss_1347_avge_mass "1347.2563" xref: spec_1_neutral_loss_1347_flag "false" xref: spec_1_neutral_loss_1347_composition "Sulf dHex(2) Hex HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1347_mono_mass "1346.442946" xref: spec_1_neutral_loss_1347_avge_mass "1347.2563" xref: spec_1_neutral_loss_1347_flag "false" xref: spec_1_neutral_loss_1347_composition "Sulf dHex(2) Hex HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1952 name: dHex(1)Hex(2)HexNAc(4)Sulf(2) def: "DHex Hex(2) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=1&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1952] xref: record_id "1952" xref: delta_mono_mass "1442.394675" xref: delta_avge_mass "1443.3189" xref: delta_composition "Sulf(2) dHex Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 12:56:06" xref: date_time_modified "2017-11-24 12:57:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1443_mono_mass "1442.394675" xref: spec_1_neutral_loss_1443_avge_mass "1443.3189" xref: spec_1_neutral_loss_1443_flag "false" xref: spec_1_neutral_loss_1443_composition "Sulf(2) dHex Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1443_mono_mass "1442.394675" xref: spec_1_neutral_loss_1443_avge_mass "1443.3189" xref: spec_1_neutral_loss_1443_flag "false" xref: spec_1_neutral_loss_1443_composition "Sulf(2) dHex Hex(2) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1953 name: Hex(9) def: "Hex(9)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=9&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1953] xref: record_id "1953" xref: delta_mono_mass "1458.475412" xref: delta_avge_mass "1459.2654" xref: delta_composition "Hex(9)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 12:58:01" xref: date_time_modified "2017-11-24 12:58:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1459_mono_mass "1458.475412" xref: spec_1_neutral_loss_1459_avge_mass "1459.2654" xref: spec_1_neutral_loss_1459_flag "false" xref: spec_1_neutral_loss_1459_composition "Hex(9)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1954 name: dHex(2)Hex(3)HexNAc(3)Sulf(1) def: "Sulf dHex(2) Hex(3) HexNAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=3&hexnac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1954] xref: record_id "1954" xref: delta_mono_mass "1467.469221" xref: delta_avge_mass "1468.345" xref: delta_composition "Sulf dHex(2) Hex(3) HexNAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 12:59:19" xref: date_time_modified "2017-11-24 13:00:08" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1468_mono_mass "1467.469221" xref: spec_1_neutral_loss_1468_avge_mass "1468.345" xref: spec_1_neutral_loss_1468_flag "false" xref: spec_1_neutral_loss_1468_composition "Sulf dHex(2) Hex(3) HexNAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1468_mono_mass "1467.469221" xref: spec_1_neutral_loss_1468_avge_mass "1468.345" xref: spec_1_neutral_loss_1468_flag "false" xref: spec_1_neutral_loss_1468_composition "Sulf dHex(2) Hex(3) HexNAc(3)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1955 name: dHex(2)Hex(5)HexNAc(2)Me(1) def: "Me dHex(2) Hex(5) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?methyl=1&dhex=2&hex=5&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1955] xref: record_id "1955" xref: delta_mono_mass "1522.554331" xref: delta_avge_mass "1523.397" xref: delta_composition "Me dHex(2) Hex(5) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:02:33" xref: date_time_modified "2017-11-24 13:03:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1523_mono_mass "1522.554331" xref: spec_1_neutral_loss_1523_avge_mass "1523.397" xref: spec_1_neutral_loss_1523_flag "false" xref: spec_1_neutral_loss_1523_composition "Me dHex(2) Hex(5) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1523_mono_mass "1522.554331" xref: spec_1_neutral_loss_1523_avge_mass "1523.397" xref: spec_1_neutral_loss_1523_flag "false" xref: spec_1_neutral_loss_1523_composition "Me dHex(2) Hex(5) HexNAc(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1956 name: dHex(2)Hex(2)HexNAc(4)Sulf(2) def: "Sulf(2) dHex(2) Hex(2) HexNAc(4)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=2&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1956] xref: record_id "1956" xref: delta_mono_mass "1588.452584" xref: delta_avge_mass "1589.4601" xref: delta_composition "Sulf(2) dHex(2) Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:04:31" xref: date_time_modified "2017-11-24 13:05:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1589_mono_mass "1588.452584" xref: spec_1_neutral_loss_1589_avge_mass "1589.4601" xref: spec_1_neutral_loss_1589_flag "false" xref: spec_1_neutral_loss_1589_composition "Sulf(2) dHex(2) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1589_mono_mass "1588.452584" xref: spec_1_neutral_loss_1589_avge_mass "1589.4601" xref: spec_1_neutral_loss_1589_flag "false" xref: spec_1_neutral_loss_1589_composition "Sulf(2) dHex(2) Hex(2) HexNAc(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1957 name: Hex(9)HexNAc(1) def: "Hex(9) HexNAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=9&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1957] xref: record_id "1957" xref: delta_mono_mass "1661.554784" xref: delta_avge_mass "1662.4579" xref: delta_composition "Hex(9) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:09:44" xref: date_time_modified "2017-11-24 13:09:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1662_mono_mass "1661.554784" xref: spec_1_neutral_loss_1662_avge_mass "1662.4579" xref: spec_1_neutral_loss_1662_flag "false" xref: spec_1_neutral_loss_1662_composition "Hex(9) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1958 name: dHex(3)Hex(2)HexNAc(4)Sulf(2) def: "DHex(3) Hex(2) HexNAc(4) Sulf(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=2&dhex=3&hex=2&hexnac=4&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1958] xref: record_id "1958" xref: delta_mono_mass "1734.510493" xref: delta_avge_mass "1735.6013" xref: delta_composition "Sulf(2) dHex(3) Hex(2) HexNAc(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:31:20" xref: date_time_modified "2017-11-24 13:31:20" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1735_mono_mass "1734.510493" xref: spec_1_neutral_loss_1735_avge_mass "1735.6013" xref: spec_1_neutral_loss_1735_flag "false" xref: spec_1_neutral_loss_1735_composition "Sulf(2) dHex(3) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1735_mono_mass "1734.510493" xref: spec_1_neutral_loss_1735_avge_mass "1735.6013" xref: spec_1_neutral_loss_1735_flag "false" xref: spec_1_neutral_loss_1735_composition "Sulf(2) dHex(3) Hex(2) HexNAc(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1959 name: Hex(4)HexNAc(4)NeuGc(1) def: "Hex(4) HexNAc(4) NeuGc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=4&hexnac=4&neugc=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1959] xref: record_id "1959" xref: delta_mono_mass "1767.619116" xref: delta_avge_mass "1768.5865" xref: delta_composition "Hex(4) HexNAc(4) NeuGc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:33:34" xref: date_time_modified "2017-11-24 13:33:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1768_mono_mass "1767.619116" xref: spec_1_neutral_loss_1768_avge_mass "1768.5865" xref: spec_1_neutral_loss_1768_flag "false" xref: spec_1_neutral_loss_1768_composition "Hex(4) HexNAc(4) NeuGc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1768_mono_mass "1767.619116" xref: spec_2_neutral_loss_1768_avge_mass "1768.5865" xref: spec_2_neutral_loss_1768_flag "false" xref: spec_2_neutral_loss_1768_composition "Hex(4) HexNAc(4) NeuGc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "T" xref: spec_2_position "Anywhere" xref: spec_2_classification "O-linked glycosylation" xref: spec_2_neutral_loss_1768_mono_mass "1767.619116" xref: spec_2_neutral_loss_1768_avge_mass "1768.5865" xref: spec_2_neutral_loss_1768_flag "false" xref: spec_2_neutral_loss_1768_composition "Hex(4) HexNAc(4) NeuGc" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1960 name: dHex(4)Hex(3)HexNAc(2)NeuAc(1) def: "DHex(4) Hex(3) HexNAc(2) NeuAc(1)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=4&hex=3&hexnac=2&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1960] xref: record_id "1960" xref: delta_mono_mass "1767.644268" xref: delta_avge_mass "1768.6262" xref: delta_composition "dHex(4) Hex(3) HexNAc(2) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:39:20" xref: date_time_modified "2017-11-24 13:40:01" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1768_mono_mass "1767.644268" xref: spec_1_neutral_loss_1768_avge_mass "1768.6262" xref: spec_1_neutral_loss_1768_flag "false" xref: spec_1_neutral_loss_1768_composition "dHex(4) Hex(3) HexNAc(2) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_neutral_loss_1768_mono_mass "1767.644268" xref: spec_1_neutral_loss_1768_avge_mass "1768.6262" xref: spec_1_neutral_loss_1768_flag "false" xref: spec_1_neutral_loss_1768_composition "dHex(4) Hex(3) HexNAc(2) NeuAc" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1961 name: Hex(3)HexNAc(5)NeuAc(1) def: "Hex(3) HexNAc(5) NeuAc(1)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=5&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1961] xref: record_id "1961" xref: delta_mono_mass "1792.65075" xref: delta_avge_mass "1793.639" xref: delta_composition "Hex(3) HexNAc(5) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:41:14" xref: date_time_modified "2017-11-24 13:41:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1793_mono_mass "1792.65075" xref: spec_1_neutral_loss_1793_avge_mass "1793.639" xref: spec_1_neutral_loss_1793_flag "false" xref: spec_1_neutral_loss_1793_composition "Hex(3) HexNAc(5) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1962 name: Hex(10)HexNAc(1) def: "Hex(10) HexNAc(1)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=10&hexnac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1962] xref: record_id "1962" xref: delta_mono_mass "1823.607608" xref: delta_avge_mass "1824.5985" xref: delta_composition "Hex(10) HexNAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:46:44" xref: date_time_modified "2017-11-24 13:46:44" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1824_mono_mass "1823.607608" xref: spec_1_neutral_loss_1824_avge_mass "1824.5985" xref: spec_1_neutral_loss_1824_flag "false" xref: spec_1_neutral_loss_1824_composition "Hex(10) HexNAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1963 name: dHex(1)Hex(8)HexNAc(2) def: "DHex Hex(8) HexNAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=1&hex=8&hexnac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1963] xref: record_id "1963" xref: delta_mono_mass "1848.639242" xref: delta_avge_mass "1849.651" xref: delta_composition "dHex Hex(8) HexNAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:48:48" xref: date_time_modified "2017-11-24 13:48:48" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1849_mono_mass "1848.639242" xref: spec_1_neutral_loss_1849_avge_mass "1849.651" xref: spec_1_neutral_loss_1849_flag "false" xref: spec_1_neutral_loss_1849_composition "dHex Hex(8) HexNAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1964 name: Hex(3)HexNAc(4)NeuAc(2) def: "Hex(3) HexNAc(4) NeuAc(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=4&neuac=2&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1964] xref: record_id "1964" xref: delta_mono_mass "1880.666794" xref: delta_avge_mass "1881.701" xref: delta_composition "Hex(3) HexNAc(4) NeuAc(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:50:19" xref: date_time_modified "2017-11-24 13:50:19" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1881_mono_mass "1880.666794" xref: spec_1_neutral_loss_1881_avge_mass "1881.701" xref: spec_1_neutral_loss_1881_flag "false" xref: spec_1_neutral_loss_1881_composition "Hex(3) HexNAc(4) NeuAc(2)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1965 name: dHex(2)Hex(3)HexNAc(4)NeuAc(1) def: "DHex(2) Hex(3) HexNAc(4) NeuAc." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?dhex=2&hex=3&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1965] xref: record_id "1965" xref: delta_mono_mass "1881.687195" xref: delta_avge_mass "1882.7289" xref: delta_composition "dHex(2) Hex(3) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 13:55:45" xref: date_time_modified "2017-11-24 13:56:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1882_mono_mass "1881.687195" xref: spec_1_neutral_loss_1882_avge_mass "1882.7289" xref: spec_1_neutral_loss_1882_flag "false" xref: spec_1_neutral_loss_1882_composition "dHex(2) Hex(3) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1966 name: dHex(2)Hex(2)HexNAc(6)Sulf(1) def: "DHex(2) Hex(2) HexNAc(6) Sulf." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?sulfate=1&dhex=2&hex=2&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1966] xref: record_id "1966" xref: delta_mono_mass "1914.654515" xref: delta_avge_mass "1915.7819" xref: delta_composition "Sulf dHex(2) Hex(2) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 14:01:17" xref: date_time_modified "2017-11-24 14:01:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1915_mono_mass "1914.654515" xref: spec_1_neutral_loss_1915_avge_mass "1915.7819" xref: spec_1_neutral_loss_1915_flag "false" xref: spec_1_neutral_loss_1915_composition "Sulf dHex(2) Hex(2) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1915_mono_mass "1914.654515" xref: spec_1_neutral_loss_1915_avge_mass "1915.7819" xref: spec_1_neutral_loss_1915_flag "false" xref: spec_1_neutral_loss_1915_composition "Sulf dHex(2) Hex(2) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1967 name: Hex(5)HexNAc(4)NeuAc(1)Ac(1) def: "Hex(5) HexNAc(4) NeuAc Ac." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=1&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1967] xref: record_id "1967" xref: delta_mono_mass "1955.687589" xref: delta_avge_mass "1956.7643" xref: delta_composition "Ac Hex(5) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 14:03:24" xref: date_time_modified "2017-11-24 14:04:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1956_mono_mass "1955.687589" xref: spec_1_neutral_loss_1956_avge_mass "1956.7643" xref: spec_1_neutral_loss_1956_flag "false" xref: spec_1_neutral_loss_1956_composition "Ac Hex(5) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1968 name: Hex(3)HexNAc(3)NeuAc(3) def: "Hex(3) HexNAc(3) NeuAc(3)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=3&hexnac=3&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1968] xref: record_id "1968" xref: delta_mono_mass "1968.682838" xref: delta_avge_mass "1969.7631" xref: delta_composition "Hex(3) HexNAc(3) NeuAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 14:05:50" xref: date_time_modified "2017-11-24 14:05:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1969_mono_mass "1968.682838" xref: spec_1_neutral_loss_1969_avge_mass "1969.7631" xref: spec_1_neutral_loss_1969_flag "false" xref: spec_1_neutral_loss_1969_composition "Hex(3) HexNAc(3) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_1969_mono_mass "1968.682838" xref: spec_1_neutral_loss_1969_avge_mass "1969.7631" xref: spec_1_neutral_loss_1969_flag "false" xref: spec_1_neutral_loss_1969_composition "Hex(3) HexNAc(3) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1969 name: Hex(5)HexNAc(4)NeuAc(1)Ac(2) def: "Hex(5) HexNAc(4) NeuAc Ac(2)." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?acetyl=2&hex=5&hexnac=4&neuac=1&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1969] xref: record_id "1969" xref: delta_mono_mass "1997.698154" xref: delta_avge_mass "1998.801" xref: delta_composition "Ac(2) Hex(5) HexNAc(4) NeuAc" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-11-24 14:06:47" xref: date_time_modified "2017-11-24 14:06:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_1998_mono_mass "1997.698154" xref: spec_1_neutral_loss_1998_avge_mass "1998.801" xref: spec_1_neutral_loss_1998_flag "false" xref: spec_1_neutral_loss_1998_composition "Ac(2) Hex(5) HexNAc(4) NeuAc" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1970 name: Unknown:162 def: "Unidentified modification of 162.1258 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1970] synonym: "The elemental composition should be assumed incorrect Although it happens to be that of Diethylene glycol butyl ether, a common solvent." [] xref: record_id "1970" xref: delta_mono_mass "162.125595" xref: delta_avge_mass "162.2267" xref: delta_composition "H(18) C(8) O(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 09:51:01" xref: date_time_modified "2018-10-17 14:27:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1971 name: Unknown:177 def: "Unidentified modification of 176.7462 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1971] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1971" xref: delta_mono_mass "176.744957" xref: delta_avge_mass "176.4788" xref: delta_composition "H(-7) O Fe(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 09:53:27" xref: date_time_modified "2017-12-07 09:53:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1972 name: Unknown:210 def: "Unidentified modification of 210.1616 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1972] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1972" xref: delta_mono_mass "210.16198" xref: delta_avge_mass "210.3126" xref: delta_composition "H(22) C(13) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 09:55:06" xref: date_time_modified "2017-12-07 09:55:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1973 name: Unknown:216 def: "Unidentified modification of 216.1002 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1973] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1973" xref: delta_mono_mass "216.099774" xref: delta_avge_mass "216.231" xref: delta_composition "H(16) C(10) O(5)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 09:59:22" xref: date_time_modified "2017-12-07 09:59:22" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1974 name: Unknown:234 def: "Unidentified modification of 234.0742 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1974] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1974" xref: delta_mono_mass "234.073953" xref: delta_avge_mass "234.2033" xref: delta_composition "H(14) C(9) O(7)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 10:00:16" xref: date_time_modified "2017-12-07 10:00:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1975 name: Unknown:248 def: "Unidentified modification of 248.1986 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1975] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1975" xref: delta_mono_mass "248.19876" xref: delta_avge_mass "248.359" xref: delta_composition "H(28) C(13) O(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 10:00:57" xref: date_time_modified "2017-12-07 10:00:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1976 name: Unknown:250 def: "Unidentified modification of 249.981 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1976] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1976" xref: delta_mono_mass "249.981018" xref: delta_avge_mass "250.2075" xref: delta_composition "H(4) C(10) N O(5) S" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 10:01:43" xref: date_time_modified "2017-12-07 10:01:43" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1977 name: Unknown:302 def: "Unidentified modification of 301.9864 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1977] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1977" xref: delta_mono_mass "301.986514" xref: delta_avge_mass "302.2656" xref: delta_composition "H(8) C(4) N(5) O(7) S(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 10:02:16" xref: date_time_modified "2017-12-07 10:02:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1978 name: Unknown:306 def: "Unidentified modification of 306.0952 found in open search." [URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1978] synonym: "The elemental composition should be assumed incorrect" [] xref: record_id "1978" xref: delta_mono_mass "306.095082" xref: delta_avge_mass "306.2659" xref: delta_composition "H(18) C(12) O(9)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 10:03:12" xref: date_time_modified "2017-12-07 10:03:12" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "D" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "E" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "C-term" xref: spec_2_position "Any C-term" xref: spec_2_classification "Artefact" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1979 name: Unknown:420 def: "Unidentified modification of 420.0506 found in open search." [URL:http\://www.matrixscience.com/blog/results-round-up-for-the-dark-matter-challenge.html, URL:http\://www.matrixscience.com/blog/trying-to-illuminate-proteomics-dark-matter.html, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1979] synonym: "Probable non-covalent adduct of CAM-DTT-DTT-CAM" [] xref: record_id "1979" xref: delta_mono_mass "420.051719" xref: delta_avge_mass "420.5888" xref: delta_composition "H(24) C(12) N(2) O(6) S(4)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2017-12-07 10:03:58" xref: date_time_modified "2019-10-17 16:01:58" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C-term" xref: spec_1_position "Any C-term" xref: spec_1_classification "Artefact" xref: spec_1_neutral_loss_421_mono_mass "420.051719" xref: spec_1_neutral_loss_421_avge_mass "420.5888" xref: spec_1_neutral_loss_421_flag "false" xref: spec_1_neutral_loss_421_composition "H(24) C(12) N(2) O(6) S(4)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Artefact" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" xref: spec_2_neutral_loss_421_mono_mass "420.051719" xref: spec_2_neutral_loss_421_avge_mass "420.5888" xref: spec_2_neutral_loss_421_flag "false" xref: spec_2_neutral_loss_421_composition "H(24) C(12) N(2) O(6) S(4)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1986 name: Diethylphosphothione def: "O-diethylphosphothione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1986] xref: record_id "1986" xref: delta_mono_mass "152.006087" xref: delta_avge_mass "152.1518" xref: delta_composition "H(9) C(4) O(2) P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2018-03-04 15:26:03" xref: date_time_modified "2018-03-08 13:03:26" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1987 name: Dimethylphosphothione def: "O-dimethylphosphothione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1987] synonym: "O-ethylphosphothione" [] xref: record_id "1987" xref: delta_mono_mass "123.974787" xref: delta_avge_mass "124.0987" xref: delta_composition "H(5) C(2) O(2) P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2018-03-04 15:31:14" xref: date_time_modified "2018-03-08 13:02:30" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1989 name: monomethylphosphothione def: "O-methylphosphothione." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1989] comment: Created by auto-catalytic dealkylation of the O-dimethylphosphothione adduct. xref: record_id "1989" xref: delta_mono_mass "109.959137" xref: delta_avge_mass "110.0721" xref: delta_composition "H(3) C O(2) P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2018-03-04 16:13:58" xref: date_time_modified "2018-03-08 13:04:11" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1990 name: CIGG def: "Ubiquitin D (FAT10) leaving after chymotrypsin digestion Cys-Ile-Gly-Gly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1990] xref: record_id "1990" xref: delta_mono_mass "330.136176" xref: delta_avge_mass "330.4032" xref: delta_composition "H(22) C(13) N(4) O(4) S" xref: username_of_poster "cosmoguidry" xref: group_of_poster "" xref: date_time_posted "2018-03-13 12:00:08" xref: date_time_modified "2018-03-16 10:22:17" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1991 name: GNLLFLACYCIGG def: "Ubiquitin D (FAT10) leaving after trypsin digestion Gly-Asn-Leu-Leu-Phe-Leu-Ala-Cys-Tyr-Cys-Ile-Gly-Gly." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1991] xref: record_id "1991" xref: delta_mono_mass "1324.6308" xref: delta_avge_mass "1325.598" xref: delta_composition "H(92) C(61) N(14) O(15) S(2)" xref: username_of_poster "cosmoguidry" xref: group_of_poster "" xref: date_time_posted "2018-03-15 15:07:14" xref: date_time_modified "2018-03-16 10:21:49" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1992 name: serotonylation def: "5-glutamyl serotonin." [RESID:AA0528, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1992] xref: record_id "1992" xref: delta_mono_mass "159.068414" xref: delta_avge_mass "159.1846" xref: delta_composition "H(9) C(10) N O" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2018-04-17 09:27:35" xref: date_time_modified "2018-04-17 09:27:35" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Q" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1993 name: TMPP-Ac:13C(9) def: "Heavy tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1993] comment: The formula is reduced from H(34) to H(33) so as to give correct observed m/z values. The charge on the TMPP means that ions have one less proton than would be expected. xref: record_id "1993" xref: delta_mono_mass "581.211328" xref: delta_avge_mass "581.474" xref: delta_composition "H(33) C(20) 13C(9) O(10) P" xref: username_of_poster "rompais" xref: group_of_poster "" xref: date_time_posted "2018-06-26 13:54:23" xref: date_time_modified "2018-06-26 15:21:14" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N-term" xref: spec_1_position "Any N-term" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "K" xref: spec_2_position "Anywhere" xref: spec_2_classification "Artefact" xref: spec_2_misc_notes "possible side chain reaction when labeling N-term" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "Y" xref: spec_3_position "Anywhere" xref: spec_3_classification "Artefact" xref: spec_3_misc_notes "possible side chain reaction when labeling N-term" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:1999 name: Xlink:DST[56] def: "DST crosslinker cleaved by sodium periodate." [URL:https\://assets.thermofisher.com/TFS-Assets/LSG/manuals/MAN0011282_DST_UG.pdf, PMID:212103, PMID:3001048, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=1999] xref: record_id "1999" xref: delta_mono_mass "55.989829" xref: delta_avge_mass "56.0202" xref: delta_composition "C(2) O(2)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2018-08-29 11:31:26" xref: date_time_modified "2018-08-29 11:37:13" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2001 name: ZQG def: "Carbobenzoxy-L-glutaminyl-glycine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2001] comment: Glutamine-donor substrate for transglutaminase. xref: record_id "2001" xref: delta_mono_mass "320.100836" xref: delta_avge_mass "320.2973" xref: delta_composition "H(16) C(15) N(2) O(6)" xref: username_of_poster "Barbara Spolaore" xref: group_of_poster "" xref: date_time_posted "2018-09-18 12:01:47" xref: date_time_modified "2019-06-05 10:18:16" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_neutral_loss_135_mono_mass "134.036779" xref: spec_1_neutral_loss_135_avge_mass "134.132" xref: spec_1_neutral_loss_135_flag "false" xref: spec_1_neutral_loss_135_composition "H(6) C(8) O(2)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2006 name: Haloxon def: "O-Dichloroethylphosphate." [PMID:4677141, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2006] xref: record_id "2006" xref: delta_mono_mass "203.950987" xref: delta_avge_mass "204.9763" xref: delta_composition "H(7) C(4) O(3) P Cl(2)" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2019-03-21 14:40:01" xref: date_time_modified "2019-03-21 15:45:39" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "T" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "Y" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2007 name: Methamidophos-S def: "S-methyl amino phosphinate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2007] xref: record_id "2007" xref: delta_mono_mass "108.975121" xref: delta_avge_mass "109.0873" xref: delta_composition "H(4) C N O P S" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2019-03-22 16:54:28" xref: date_time_modified "2019-05-22 14:56:50" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2008 name: Methamidophos-O def: "O-methyl amino phosphinate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2008] xref: record_id "2008" xref: delta_mono_mass "92.997965" xref: delta_avge_mass "93.0217" xref: delta_composition "H(4) C N O(2) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2019-03-22 17:03:48" xref: date_time_modified "2019-05-22 14:57:05" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "H" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "K" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "S" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "T" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "Y" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2014 name: Nitrene def: "Loss of O2; nitro photochemical decomposition." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2014] xref: record_id "2014" xref: delta_mono_mass "12.995249" xref: delta_avge_mass "12.9988" xref: delta_composition "H(-1) N" xref: username_of_poster "alhansen" xref: group_of_poster "" xref: date_time_posted "2019-07-10 21:24:33" xref: date_time_modified "2019-09-10 09:30:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Artefact" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2015 name: shTMT def: "Super Heavy Tandem Mass Tag." [URL:https\://www.thermofisher.com/order/catalog/product/A43073, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2015] comment: This modification describes the Super Heavy TMT Reagent. Upon HCD, this reagent releases a reporter ion of 132.14153 (monoisotopic mass). synonym: "Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc. Super Heavy TMT" [] xref: record_id "2015" xref: delta_mono_mass "235.176741" xref: delta_avge_mass "235.2201" xref: delta_composition "H(20) C(3) 13C(9) 15N(2) O(2)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2019-07-10 21:42:41" xref: date_time_modified "2019-09-10 09:30:18" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Protein N-term" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Any N-term" xref: spec_3_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2016 name: TMTpro def: "TMTpro 16plex Tandem Mass Tag." [URL:https\://www.thermofisher.com/order/catalog/product/A44520, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2016] comment: This modification describes the isotope-labeled TMTpro Reagent with m/z values of the TMTpro fragment ions to be quantified for 16plex: 126.127726,127. 124761, 127.131081, 128.128116, 128.134436, 129.131471, 129.13779, 130.134825, 130.141145, 131.13818, 131.1445, 132.141535, 132.147855, 133.14489, 133.15121, and 134.148245. synonym: "Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc." [] xref: record_id "2016" xref: delta_mono_mass "304.207146" xref: delta_avge_mass "304.3127" xref: delta_composition "H(25) C(8) 13C(7) N 15N(2) O(3)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2019-09-06 19:43:32" xref: date_time_modified "2019-09-10 09:11:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "0" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Isotopic label" xref: spec_2_group "2" xref: spec_2_hidden "0" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Isotopic label" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Isotopic label" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Isotopic label" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Isotopic label" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Isotopic label" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2017 name: TMTpro_zero def: "Native TMTpro Tandem Mass Tag." [URL:https\://www.thermofisher.com/order/catalog/product/A44518, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2017] comment: This modification describes the native TMTpro Reagent without isotopic label with reporter mass m/z 126.127726. synonym: "Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc." [] xref: record_id "2017" xref: delta_mono_mass "295.189592" xref: delta_avge_mass "295.3773" xref: delta_composition "H(25) C(15) N(3) O(3)" xref: username_of_poster "rbomgard" xref: group_of_poster "" xref: date_time_posted "2019-09-06 20:04:30" xref: date_time_modified "2019-09-10 09:10:52" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N-term" xref: spec_2_position "Any N-term" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "N-term" xref: spec_3_position "Protein N-term" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "H" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" xref: spec_5_group "5" xref: spec_5_hidden "1" xref: spec_5_site "S" xref: spec_5_position "Anywhere" xref: spec_5_classification "Chemical derivative" xref: spec_6_group "6" xref: spec_6_hidden "1" xref: spec_6_site "T" xref: spec_6_position "Anywhere" xref: spec_6_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2022 name: Kdo def: "Glycosylation with KDO." [PMID:https://pubmed.ncbi.nlm.nih.gov/32886756/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2022] synonym: "3-deoxy-D-manno-oct-2-ulosonic acid 2-Keto-3-Deoxy-D-Mannooctanoic Acid" [] xref: record_id "2022" xref: delta_mono_mass "220.058303" xref: delta_avge_mass "220.1767" xref: delta_composition "H(12) C(8) O(7)" xref: username_of_poster "ramya" xref: group_of_poster "" xref: date_time_posted "2020-02-13 12:07:17" xref: date_time_modified "2020-09-09 12:47:42" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_221_mono_mass "220.058303" xref: spec_1_neutral_loss_221_avge_mass "220.1767" xref: spec_1_neutral_loss_221_flag "false" xref: spec_1_neutral_loss_221_composition "H(12) C(8) O(7)" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_221_mono_mass "220.058303" xref: spec_1_neutral_loss_221_avge_mass "220.1767" xref: spec_1_neutral_loss_221_flag "false" xref: spec_1_neutral_loss_221_composition "H(12) C(8) O(7)" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2025 name: Andro-H2O def: "Andrographolide with the loss of H2O." [PMID:24445406, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2025] xref: record_id "2025" xref: delta_mono_mass "332.19876" xref: delta_avge_mass "332.4339" xref: delta_composition "H(28) C(20) O(4)" xref: username_of_poster "nekoooooo" xref: group_of_poster "" xref: date_time_posted "2020-05-18 08:48:39" xref: date_time_modified "2020-05-26 15:47:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2027 name: His+O(2) def: "Photo-induced histidine adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2027] xref: record_id "2027" xref: delta_mono_mass "169.048741" xref: delta_avge_mass "169.1381" xref: delta_composition "H(7) C(6) N(3) O(3)" xref: username_of_poster "tomp1808" xref: group_of_poster "" xref: date_time_posted "2020-06-01 16:45:37" xref: date_time_modified "2020-06-09 11:01:57" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2028 name: Hex(6)HexNAc(5)NeuAc(3) def: "A3G3S3." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=6&hexnac=5&neuac=3&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2028] xref: record_id "2028" xref: delta_mono_mass "2861.000054" xref: delta_avge_mass "2862.5699" xref: delta_composition "Hex(6) HexNAc(5) NeuAc(3)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2020-08-02 11:44:31" xref: date_time_modified "2020-08-02 11:44:31" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "N" xref: spec_1_position "Anywhere" xref: spec_1_classification "N-linked glycosylation" xref: spec_1_neutral_loss_2862_mono_mass "2861.000054" xref: spec_1_neutral_loss_2862_avge_mass "2862.5699" xref: spec_1_neutral_loss_2862_flag "false" xref: spec_1_neutral_loss_2862_composition "Hex(6) HexNAc(5) NeuAc(3)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2029 name: Hex(7)HexNAc(6) def: "A4G4." [URL:https\://glyconnect.expasy.org/browser/global/compositions/search?hex=7&hexnac=6&mode=exact, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2029] xref: record_id "2029" xref: delta_mono_mass "2352.846" xref: delta_avge_mass "2354.1393" xref: delta_composition "Hex(7) HexNAc(6)" xref: username_of_poster "unimod" xref: group_of_poster "" xref: date_time_posted "2020-08-02 11:47:40" xref: date_time_modified "2020-08-02 11:47:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "S" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_2353_mono_mass "2352.846" xref: spec_1_neutral_loss_2353_avge_mass "2354.1393" xref: spec_1_neutral_loss_2353_flag "false" xref: spec_1_neutral_loss_2353_composition "Hex(7) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "T" xref: spec_1_position "Anywhere" xref: spec_1_classification "O-linked glycosylation" xref: spec_1_neutral_loss_2353_mono_mass "2352.846" xref: spec_1_neutral_loss_2353_avge_mass "2354.1393" xref: spec_1_neutral_loss_2353_flag "false" xref: spec_1_neutral_loss_2353_composition "Hex(7) HexNAc(6)" xref: spec_1_neutral_loss_0_mono_mass "0" xref: spec_1_neutral_loss_0_avge_mass "0" xref: spec_1_neutral_loss_0_flag "false" xref: spec_1_neutral_loss_0_composition "0" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "N" xref: spec_2_position "Anywhere" xref: spec_2_classification "N-linked glycosylation" xref: spec_2_neutral_loss_2353_mono_mass "2352.846" xref: spec_2_neutral_loss_2353_avge_mass "2354.1393" xref: spec_2_neutral_loss_2353_flag "false" xref: spec_2_neutral_loss_2353_composition "Hex(7) HexNAc(6)" xref: spec_2_neutral_loss_0_mono_mass "0" xref: spec_2_neutral_loss_0_avge_mass "0" xref: spec_2_neutral_loss_0_flag "false" xref: spec_2_neutral_loss_0_composition "0" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2033 name: Met+O(2) def: "Photo-induced Methionine Adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2033] xref: record_id "2033" xref: delta_mono_mass "163.030314" xref: delta_avge_mass "163.1949" xref: delta_composition "H(9) C(5) N O(3) S" xref: username_of_poster "tomp1808" xref: group_of_poster "" xref: date_time_posted "2021-02-01 10:35:58" xref: date_time_modified "2021-03-09 13:26:40" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Oxidative cross-link of free methionine to histidine residue in protein." is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2034 name: Gly+O(2) def: "Photo-induced Glycine Adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2034] xref: record_id "2034" xref: delta_mono_mass "89.011293" xref: delta_avge_mass "89.0501" xref: delta_composition "H(3) C(2) N O(3)" xref: username_of_poster "tomp1808" xref: group_of_poster "" xref: date_time_posted "2021-02-01 13:18:42" xref: date_time_modified "2021-03-09 13:27:33" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2035 name: Pro+O(2) def: "Photo-induced Proline adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2035] xref: record_id "2035" xref: delta_mono_mass "129.042593" xref: delta_avge_mass "129.114" xref: delta_composition "H(7) C(5) N O(3)" xref: username_of_poster "tomp1808" xref: group_of_poster "" xref: date_time_posted "2021-02-01 13:30:11" xref: date_time_modified "2021-03-09 13:28:02" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2036 name: Lys+O(2) def: "Photo-induced Lysine adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2036] xref: record_id "2036" xref: delta_mono_mass "160.084792" xref: delta_avge_mass "160.1711" xref: delta_composition "H(12) C(6) N(2) O(3)" xref: username_of_poster "tomp1808" xref: group_of_poster "" xref: date_time_posted "2021-02-01 13:33:53" xref: date_time_modified "2021-03-09 13:28:34" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2037 name: Glu+O(2) def: "Photo-induced Glutamate adduct." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2037] xref: record_id "2037" xref: delta_mono_mass "161.032422" xref: delta_avge_mass "161.1128" xref: delta_composition "H(7) C(5) N O(5)" xref: username_of_poster "tomp1808" xref: group_of_poster "" xref: date_time_posted "2021-02-01 13:35:06" xref: date_time_modified "2021-03-09 13:28:59" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "H" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2039 name: LTX+Lophotoxin def: "Addition of lophotoxin to tyrosine." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2039] xref: record_id "2039" xref: delta_mono_mass "416.147118" xref: delta_avge_mass "416.4212" xref: delta_composition "H(24) C(22) O(8)" xref: username_of_poster "modchaser99" xref: group_of_poster "" xref: date_time_posted "2021-02-17 23:23:43" xref: date_time_modified "2021-03-09 13:32:47" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "Y" xref: spec_1_position "Anywhere" xref: spec_1_classification "Post-translational" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2040 name: MBS+peptide def: "MBS_233p24 plus peptide 1250p53." [URL:https\://www.thermofisher.com/order/catalog/product/22311?us&en#/22311?us&en, PMID:https://pubmed.ncbi.nlm.nih.gov/8829804/, UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2040] xref: record_id "2040" xref: delta_mono_mass "1482.77" xref: delta_avge_mass "1483.7597" xref: delta_composition "H(108) C(81) N(7) O(19)" xref: username_of_poster "nendicott" xref: group_of_poster "" xref: date_time_posted "2021-02-24 17:50:09" xref: date_time_modified "2021-03-09 13:32:27" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "C" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_1_misc_notes "Loss of MBS, peptide from KLH after trypsin digestion" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2041 name: 3-hydroxybenzyl-phosphate def: "3-hydroxybenzyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2041] comment: Created by hydrolysis of the product of the reaction of 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one with amino acids residues in proteins. xref: record_id "2041" xref: delta_mono_mass "186.008196" xref: delta_avge_mass "186.1018" xref: delta_composition "H(7) C(7) O(4) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2021-03-07 21:17:23" xref: date_time_modified "2021-03-09 13:34:53" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node [Term] id: UNIMOD:2042 name: phenyl-phosphate def: "Phenyl phosphate." [UNIMODURL:http\://www.unimod.org/modifications_view.php?editid1=2042] comment: Created by hydrolysis of the product of the reaction of 2-(o-cresyl)-4H-1,3,2-benzodioxaphosphorane-2-one with amino acids residues in proteins. xref: record_id "2042" xref: delta_mono_mass "155.997631" xref: delta_avge_mass "156.0759" xref: delta_composition "H(5) C(6) O(3) P" xref: username_of_poster "lmschopfer" xref: group_of_poster "" xref: date_time_posted "2021-03-07 21:23:37" xref: date_time_modified "2021-03-09 13:36:06" xref: approved "0" xref: spec_1_group "1" xref: spec_1_hidden "1" xref: spec_1_site "K" xref: spec_1_position "Anywhere" xref: spec_1_classification "Chemical derivative" xref: spec_2_group "2" xref: spec_2_hidden "1" xref: spec_2_site "S" xref: spec_2_position "Anywhere" xref: spec_2_classification "Chemical derivative" xref: spec_3_group "3" xref: spec_3_hidden "1" xref: spec_3_site "T" xref: spec_3_position "Anywhere" xref: spec_3_classification "Chemical derivative" xref: spec_4_group "4" xref: spec_4_hidden "1" xref: spec_4_site "Y" xref: spec_4_position "Anywhere" xref: spec_4_classification "Chemical derivative" is_a: UNIMOD:0 ! unimod root node